| Basic Information | |
|---|---|
| Taxon OID | 2044078004 Open in IMG/M |
| Scaffold ID | PVR_F5IW0KN15JBX7N Open in IMG/M |
| Source Dataset Name | Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 506 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere → Switchgrass, Maize And Miscanthus Rhizosphere Microbial Communities From University Of Illinois Energy Farm, Urbana, Il |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UIUC Energy Farm, Urbana, Illinois 61801 | |||||||
| Coordinates | Lat. (o) | 40.109722 | Long. (o) | -88.204167 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074717 | Metagenome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PVR_1626370 | F074717 | GGA | MTYKRKSVAMYVTQKWYALTGRIVDAKVEADGDIHLALQDANSHNAGTVSAEIPVGPKWCEIRQVVFGWTTQKFPFAVKTAHALKLASRTSS |
| ⦗Top⦘ |