| Basic Information | |
|---|---|
| Taxon OID | 2040502001 Open in IMG/M |
| Scaffold ID | FACENC_GAMC6GA01AQIRN Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 505 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Orange County, North Carolina | |||||||
| Coordinates | Lat. (o) | 36.0 | Long. (o) | -80.934 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001290 | Metagenome / Metatranscriptome | 730 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FACENCE_3695310 | F001290 | GGAGG | LNAKSIAGWLALALVIWWVIEAPTSAAHVVHNIGTFLSSAASGITQFFASI |
| ⦗Top⦘ |