| Basic Information | |
|---|---|
| Taxon OID | 2040502000 Open in IMG/M |
| Scaffold ID | ACOD_F64RS5002GVU93 Open in IMG/M |
| Source Dataset Name | Fungus garden microbial communities from Atta colombica in Panama - dump bottom |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences, DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 504 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia pedi | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden → Fungus Garden Microbial Communities From Leaf-Cutting Ants In Gamboa, Panama |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gamboa, Panama | |||||||
| Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010498 | Metagenome / Metatranscriptome | 303 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ACODB_5655100 | F010498 | GGA | MQHPPQSRWQKRVFEDVLKERRYQERQWGQDVDDNLNTPWMWCAYICSYATKWMKNPHLWTRDDTEEFYDRMIQTSAIAAAAAESVLRQRETHGKTFYESDPGPSSEMR |
| ⦗Top⦘ |