| Basic Information | |
|---|---|
| Taxon OID | 2035265000 Open in IMG/M |
| Scaffold ID | ErSWdraf_F5BXKTZ02JKDHH Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Royal Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 552 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Swedish Lakes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erken, Sweden | |||||||
| Coordinates | Lat. (o) | 59.84 | Long. (o) | 18.63 | Alt. (m) | Depth (m) | 0 to 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035757 | Metagenome / Metatranscriptome | 171 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ErSWdraft_12844570 | F035757 | GGAG | MNKFAVVITSFVYGPLEGSTVSIQVIVNSPMTAKQLRTFYLCSHSKVSDVYVEQL |
| ⦗Top⦘ |