Scaffold ErSWdraf_F5BXKTZ02IE659

Overview

Basic Information

• Taxon OID: 2035265000
• Scaffold ID: ErSWdraf_F5BXKTZ02IE659
• Source Dataset Name: Freshwater microbial communities from Swedish Lakes - surface of Lake Erken
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Royal Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 564
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Swedish Lakes

Source Dataset Sampling Location

• Location Name: Lake Erken, Sweden
• Coordinates
  • Lat. (^o): 59.84
  • Long. (^o): 18.63
  • Depth (m): 0 to 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023542	Metagenome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
ErSWdraft_2566430	F023542	N/A	MDILEIAIKASGGTGRLAYILDIRQNVVSNWRQRGVPKGWQQVLRYKFKKQIAEQQKIV