| Basic Information | |
|---|---|
| Taxon OID | 2032320006 Open in IMG/M |
| Scaffold ID | FACEOR_FYWIORV02IMEK2 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 500 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Oak Ridge Integrated Field Research Center, Tennessee, USA | |||||||
| Coordinates | Lat. (o) | 35.94106884 | Long. (o) | -84.4 | Alt. (m) | Depth (m) | .05 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049193 | Metagenome / Metatranscriptome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FACEORE_67110 | F049193 | GGAGG | MKALALTASVSIGVFAFASAAQAQQARKLFFEGDIVRHALADQAGPFCVLNNQFKRKEAIAWRIRVLEPSGATADNKVLKSVVVRLGNGQELPAPLRPARNAADRSFLVAVLDYSS |
| ⦗Top⦘ |