Basic Information | |
---|---|
Taxon OID | 2032320005 Open in IMG/M |
Scaffold ID | FACEOR_FY84VJD01DN3YB Open in IMG/M |
Source Dataset Name | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 525 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Oak Ridge National Environmental Research Park, Tennessee, USA | |||||||
Coordinates | Lat. (o) | 35.9 | Long. (o) | -84.4 | Alt. (m) | Depth (m) | .05 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019315 | Metagenome / Metatranscriptome | 230 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FACEORA_440600 | F019315 | GGGGG | VHHVRFTRADGMFTTQDRERAGLLAKRLGLTVELAG |
⦗Top⦘ |