| Basic Information | |
|---|---|
| Taxon OID | 2032320004 Open in IMG/M |
| Scaffold ID | FACEMD_FWMYIUC02HCGA8 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 520 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Maryland Wetland Ecosystem, MD | |||||||
| Coordinates | Lat. (o) | 38.85 | Long. (o) | -76.53333 | Alt. (m) | Depth (m) | .01 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036181 | Metagenome / Metatranscriptome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FACEMDA_1036720 | F036181 | GGA | VRAERIAEVQRQLAQGLARIDPHHRLMGRPVSYRVIDGETLEITFRDVAGIAEAEFSA |
| ⦗Top⦘ |