 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2028778002 Open in IMG/M |
| Scaffold ID | BlanesLi_DSAD-090629_plate64E08b_b1 Open in IMG/M |
| Source Dataset Name | Marine surface waters microbial communities from Blanes Bay, Balearic Sea - 299 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Washington University in St. Louis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1015 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine Surface Waters → Marine Surface Waters Microbial Communities From Blanes Bay, Balearic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Blanes Bay, Balearic Sea | |||||||
| Coordinates | Lat. (o) | 41.670501 | Long. (o) | 2.800182 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050679 | Metagenome / Metatranscriptome | 145 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Blanes_lib_60530 | F050679 | N/A | MANKTKKNPKVLQEIYEELATGASIRSCLSPRNKKEDRPCWQSFRTWMAKDPEIRKNYEQAKTDGIEYLLSDATDTINQALEDSKFKEKTDLGQTHLIKSFIDLPKWKSERLAPKTYMKKDSLQLLGSDSSPLVVKWDK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |