Basic Information | |
---|---|
Taxon OID | 2028778002 Open in IMG/M |
Scaffold ID | BlanesLi_DSAD-090629_plate49D07b_b1 Open in IMG/M |
Source Dataset Name | Marine surface waters microbial communities from Blanes Bay, Balearic Sea - 299 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Washington University in St. Louis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1030 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine Surface Waters → Marine Surface Waters Microbial Communities From Blanes Bay, Balearic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Blanes Bay, Balearic Sea | |||||||
Coordinates | Lat. (o) | 41.670501 | Long. (o) | 2.800182 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040331 | Metagenome | 162 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Blanes_lib_64900 | F040331 | N/A | MLDMFKTNQLKETMTNQELKKKVISSMKKDDELEKYVKDFQDLSTEQFDILMKIIDRAYLKVKNQ |
⦗Top⦘ |