NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BlanesLi_DSAD-090629_plate49D07b_b1

Scaffold BlanesLi_DSAD-090629_plate49D07b_b1


Overview

Basic Information
Taxon OID2028778002 Open in IMG/M
Scaffold IDBlanesLi_DSAD-090629_plate49D07b_b1 Open in IMG/M
Source Dataset NameMarine surface waters microbial communities from Blanes Bay, Balearic Sea - 299
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterWashington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1030
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine Surface Waters → Marine Surface Waters Microbial Communities From Blanes Bay, Balearic Sea

Source Dataset Sampling Location
Location NameBlanes Bay, Balearic Sea
CoordinatesLat. (o)41.670501Long. (o)2.800182Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040331Metagenome162N

Sequences

Protein IDFamilyRBSSequence
Blanes_lib_64900F040331N/AMLDMFKTNQLKETMTNQELKKKVISSMKKDDELEKYVKDFQDLSTEQFDILMKIIDRAYLKVKNQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.