| Basic Information | |
|---|---|
| Taxon OID | 2028778002 Open in IMG/M |
| Scaffold ID | BlanesLi_DSAD-090629_plate13D04b_b1 Open in IMG/M |
| Source Dataset Name | Marine surface waters microbial communities from Blanes Bay, Balearic Sea - 299 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Washington University in St. Louis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1097 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine Surface Waters → Marine Surface Waters Microbial Communities From Blanes Bay, Balearic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Blanes Bay, Balearic Sea | |||||||
| Coordinates | Lat. (o) | 41.670501 | Long. (o) | 2.800182 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026784 | Metagenome / Metatranscriptome | 196 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Blanes_lib_60560 | F026784 | N/A | MWLVVTVSLVKKRLPNQTDVAVLRAVSKGMRDAVDATRRKVEEFEEDDAAERGYVSTLKCLRRRGRLSDECLLCAAAARIGDLEALKAFRAENFGFRV |
| ⦗Top⦘ |