Scaffold ADn_FTWC1V111GX2SH

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ADn_FTWC1V111GX2SH

Scaffold ADn_FTWC1V111GX2SH

Overview

Basic Information
Taxon OID	2027040000 Open in IMG/M
Scaffold ID	ADn_FTWC1V111GX2SH Open in IMG/M
Source Dataset Name	Wastewater viral communities from wastewater treatment facility in Singapore - AD-no assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	514
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore

Source Dataset Sampling Location
Location Name	Singapore: Singapore
Coordinates	Lat. (^o)	1.332	Long. (^o)	103.756	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058173	Metagenome / Metatranscriptome	135	N

Sequences

Protein ID	Family	RBS	Sequence
AD_na_6736980	F058173	AGGAG	MKMTYLIGVVVALVLIIVAFSIGKHYPSEDIVGQLTEQIRKETIKQYEQRIADLDRQLKVSQTAYIESQKRYDTIIKRLKELRDGKDSIKPPQDSGELTARFNNLGYTPVGK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.