Scaffold YNPsite05_CeleraDRAF_80696

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YNPsite05_CeleraDRAF_80696

Scaffold YNPsite05_CeleraDRAF_80696

Overview

Basic Information
Taxon OID	2022920003 Open in IMG/M
Scaffold ID	YNPsite05_CeleraDRAF_80696 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP5 Bath Lake Vista Annex
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	648
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.96507	Long. (^o)	-110.71215	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036493	Metagenome	170	N

Sequences

Protein ID	Family	RBS	Sequence
YNPsite05_CeleraDRAFT_47440	F036493	GGAGG	MLKCGLNASVKRVRVMLLSSIALSSTLVWVLTVAVAVVASIKVRQSSVFNALIAIASTLVWATVAPGVSLHVRYWPTIAFALLGIL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.