Basic Information | |
---|---|
Taxon OID | 2022920002 Open in IMG/M |
Scaffold ID | YNPsite03_CeleraDRAF_scf1118686647876 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP3 Monarch Geyser, Norris Geyser Basin |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1069 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, WY | |||||||
Coordinates | Lat. (o) | 44.7242925 | Long. (o) | -110.7056131 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023140 | Metagenome / Metatranscriptome | 211 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
YNPsite03_CeleraDRAFT_197080 | F023140 | N/A | SNSSAMSVVWCYSLKLHERILISNVFIGLATVPIYIFLKSFPFFIVFGAGILTTLTVLILFFYFLGAKFVGTWAILQKFAVTFPTSFVLAHLVKHLPSNPLLDYIILFVVGYVISTPLIFSRII |
⦗Top⦘ |