Scaffold YNPsite03_CeleraDRAF_deg1118686643138

Overview

Basic Information

• Taxon OID: 2022920002
• Scaffold ID: YNPsite03_CeleraDRAF_deg1118686643138
• Source Dataset Name: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP3 Monarch Geyser, Norris Geyser Basin
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 665
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Acidilobales → Acidilobaceae → Acidilobus → unclassified Acidilobus → Acidilobus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, WY
• Coordinates
  • Lat. (^o): 44.7242925
  • Long. (^o): -110.7056131

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008606	Metagenome / Metatranscriptome	330	Y

Sequences

Protein ID	Family	RBS	Sequence
YNPsite03_CeleraDRAFT_39430	F008606	AGG	VVLVAEDRDPDSRSYDKLVELSEQVNELRGQVVSLAERVARLEEENRWLRQELAEIKGVVNEVRRNSVAILASVLTVFVAVVIGLIVH