Scaffold QLn_FQAYR3Y02S2XK5

Overview

Basic Information

• Taxon OID: 2022920000
• Scaffold ID: QLn_FQAYR3Y02S2XK5
• Source Dataset Name: Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 501
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake

Source Dataset Sampling Location

• Location Name: Qinghai Lake, Tibetan Plateau
• Coordinates
  • Lat. (^o): 36.381
  • Long. (^o): 100.218
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066593	Metagenome	126	N

Sequences

Protein ID	Family	RBS	Sequence
QL_na_10242260	F066593	N/A	MKIEVNYIFREEGVDPIYERIGIEIDSEVEIQEVGVLNLNHVVGASAFYELTQVYVSGGHVFYIDLPFTEFKTL