| Basic Information | |
|---|---|
| Taxon OID | 2016842008 Open in IMG/M |
| Scaffold ID | YNP20_C9471 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP20 Bath Lake Vista Annex - Purple-Sulfur Mats |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1657 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, WY | |||||||
| Coordinates | Lat. (o) | 44.96507 | Long. (o) | -110.71215 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075804 | Metagenome / Metatranscriptome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| YNP20_399400 | F075804 | N/A | MLKHISSSLSHSKKYRLWQEAYWLVLLNQALKTFTEQHLQLKNPEIRAFVRLQGQVLHVKIAAKEPTVLAALKIAQKALLDFLHQNLPQKAQLVTQLKISFLVK |
| ⦗Top⦘ |