Scaffold YNP15_FYNB3629_b1

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YNP15_FYNB3629_b1

Scaffold YNP15_FYNB3629_b1

Overview

Basic Information
Taxon OID	2015219002 Open in IMG/M
Scaffold ID	YNP15_FYNB3629_b1 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP15 Mushroom Spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	801
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.538694	Long. (^o)	-110.797972	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009254	Metagenome / Metatranscriptome	320	N

Sequences

Protein ID	Family	RBS	Sequence
YNP15332020	F009254	N/A	MRLRELEAFLRNFLARVIGAPIVSAPTEMPVGSAVAGVLSLQSREAGKAVGGMRAVYQLELLASDAIPDAARRKLYETLASQIIRTELAAERDWLPMLDYQVFLEELSIERLRVRLEVEWDADR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.