Scaffold 2014652078

Overview

Basic Information

• Taxon OID: 2014642000
• Scaffold ID: 2014652078
• Source Dataset Name: Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 2_Upper_euphotic_70m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 951
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location

• Location Name: Hawaii Ocean Time Series, North Pacific Ocean
• Coordinates
  • Lat. (^o): 22.45
  • Long. (^o): -158.0
  • Depth (m): 70

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049703	Metagenome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
2014656770	F049703	AGG	MISTLTDSKGAILSVSDKVRDEEGFTWWVLSMFPEINSVVGITTNEDRFNRKAFRPEELTICDS