| Basic Information | |
|---|---|
| Taxon OID | 2014642000 Open in IMG/M |
| Scaffold ID | 2014646749 Open in IMG/M |
| Source Dataset Name | Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 2_Upper_euphotic_70m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1008 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hawaii Ocean Time Series, North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 22.45 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 70 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043984 | Metagenome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2014648967 | F043984 | GGGGG | MSMSIADMYQEMIDQYTEMYMYRKTHKGIRGSDPHEDILDDMSAVEVDMEYTNES |
| ⦗Top⦘ |