| Basic Information | |
|---|---|
| Taxon OID | 2014031003 Open in IMG/M |
| Scaffold ID | YNP3_C3998 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP3 Monarch Geyser, Norris Geyser Basin |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1622 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, WY | |||||||
| Coordinates | Lat. (o) | 44.7242925 | Long. (o) | -110.7056131 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039967 | Metagenome | 162 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| YNP3_116940 | F039967 | GGAGG | MIASIGVGVGLVAPYGAIEKVTVPEGLKLSQDIMASAVTVLLGLTVFGTSVRNMLQPPYGGTWTWLNTSTSVYMALGAFIAIRDKAD |
| ⦗Top⦘ |