Scaffold UBABS_BWON22702_y1

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold UBABS_BWON22702_y1

Scaffold UBABS_BWON22702_y1

Overview

Basic Information
Taxon OID	2010484004 Open in IMG/M
Scaffold ID	UBABS_BWON22702_y1 Open in IMG/M
Source Dataset Name	Acid Mine Drainage (ARMAN) microbial communities from Richmond mine, Iron Mountain, CA, sample from Ultra Back A BS
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI), University of California, Berkeley
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	823
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage (Amd) → Acid Mine Drainage (Amd) Microbial And Viral Communities From Richmond Mine, Iron Mountain, Ca

Source Dataset Sampling Location
Location Name	Iron Mountain California
Coordinates	Lat. (^o)	40.678099	Long. (^o)	-122.515068	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026917	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
UBABS_240240	F026917	GGAG	MIHAADMCDAERQIRQKVIMVVADETRFGTLSTGERIAVALVLERYDLLQRAWGRMLESVHRLGPLWTEAALRVQRQGWEEDPTS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.