Scaffold BISONP_C14708

Overview

Basic Information

• Taxon OID: 2010170003
• Scaffold ID: BISONP_C14708
• Source Dataset Name: 5_050719P
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3161
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Source Dataset Sampling Location

• Location Name: Bison Pool / Rosette Geyser, Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.6
  • Long. (^o): -110.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028182	Metagenome / Metatranscriptome	192	N

Sequences

Protein ID	Family	RBS	Sequence
BISONP_332340	F028182	GGCGG	MRYNTLVMPKVSISEAARRLDTTEEVIREWIRLGLLDVEPLPLERQRAKENILALHVSGIDLDSCVRGIDSEPRVDLEQLYEVAEREGWLLLSLEAWDAADSEP