| Basic Information | |
|---|---|
| Taxon OID | 2006207004 Open in IMG/M |
| Scaffold ID | lwFormate_BCIX20766_g1 Open in IMG/M |
| Source Dataset Name | Sediment methylotrophic communities from Lake Washington - Formate enrichment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 824 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Washington, Seattle, USA | |||||||
| Coordinates | Lat. (o) | 47.676484 | Long. (o) | -122.228394 | Alt. (m) | Depth (m) | 63 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024397 | Metagenome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LWFOR_40988 | F024397 | GGCGG | MDDIGRLVLSQEQASANYATRQVRCRRTAEVSWEVVDANTGVAVATGLVSRDEALRFVRGWERLSLKLDGGLDGHQLLH |
| ⦗Top⦘ |