| Basic Information | |
|---|---|
| Taxon OID | 2001200001 Open in IMG/M |
| Scaffold ID | 2001267435 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1274 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Waseca County, Minnesota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Waseca County, Minnesota, USA | |||||||
| Coordinates | Lat. (o) | 44.152652 | Long. (o) | -93.519745 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F095096 | Metagenome | 105 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2001309683 | F095096 | AGG | MRSWRLLLSDVAINEVGLEVTYADVFVVLREGDEAPGPNDWEVTLRTSDRHELLPGTYEVRGGTPDHQSLSGHAILRYSDGHHHHFRGDGHLGGVEGVVA |
| ⦗Top⦘ |