NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F106142

Metagenome Family F106142

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106142
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 95 residues
Representative Sequence MQRNFILTDVMKTGNHGKLEQFISYHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAMIDVRHQNDRLKDNTEFNTELKKRCDLLHSQGFIFIKASPWESLD
Number of Associated Samples 97
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 47.83 %
% of genes near scaffold ends (potentially truncated) 90.00 %
% of genes from short scaffolds (< 2000 bps) 83.00 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.77

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(29.000 % of family members)
Environment Ontology (ENVO) Unclassified
(80.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.81%    β-sheet: 18.75%    Coil/Unstructured: 48.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.77
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.2.1.0: automated matchesd3slga_3slg0.68838
c.37.1.8: G proteinsd1svsa11svs0.67459
c.37.1.10: Nitrogenase iron protein-liked4ioja_4ioj0.66511
c.23.10.6: Hypothetical protein alr1529d1z8ha_1z8h0.66145
c.42.1.0: automated matchesd4g3ha_4g3h0.65625

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF05050Methyltransf_21 13.00
PF08241Methyltransf_11 2.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.00 %
UnclassifiedrootN/A13.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001355|JGI20158J14315_10229174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41515Open in IMG/M
3300001419|JGI11705J14877_10149290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37635Open in IMG/M
3300001450|JGI24006J15134_10052391All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411658Open in IMG/M
3300001460|JGI24003J15210_10031340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411933Open in IMG/M
3300001953|GOS2231_1035102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED371570Open in IMG/M
3300005401|Ga0066857_10139427Not Available865Open in IMG/M
3300005520|Ga0066864_10014104All Organisms → cellular organisms → Bacteria → Proteobacteria2550Open in IMG/M
3300005914|Ga0075117_1077323All Organisms → Viruses → Predicted Viral1015Open in IMG/M
3300006789|Ga0098054_1324472All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41549Open in IMG/M
3300006922|Ga0098045_1155111All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41525Open in IMG/M
3300006947|Ga0075444_10313543All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41603Open in IMG/M
3300009001|Ga0102963_1240369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41718Open in IMG/M
3300009172|Ga0114995_10667946All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41568Open in IMG/M
3300009193|Ga0115551_1400546All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41590Open in IMG/M
3300009426|Ga0115547_1119078All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41859Open in IMG/M
3300009435|Ga0115546_1287399All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41561Open in IMG/M
3300009437|Ga0115556_1290268All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41577Open in IMG/M
3300009443|Ga0115557_1215059All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41747Open in IMG/M
3300009496|Ga0115570_10472369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41526Open in IMG/M
3300009498|Ga0115568_10241656All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41816Open in IMG/M
3300009505|Ga0115564_10498509All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41587Open in IMG/M
3300009601|Ga0114914_1073366All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41523Open in IMG/M
3300009705|Ga0115000_10363639All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41927Open in IMG/M
3300009790|Ga0115012_10484410All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41963Open in IMG/M
3300010151|Ga0098061_1028255All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED412267Open in IMG/M
3300010153|Ga0098059_1100145All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411152Open in IMG/M
3300010153|Ga0098059_1149564Not Available920Open in IMG/M
3300010300|Ga0129351_1256579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37667Open in IMG/M
3300010368|Ga0129324_10229714All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41745Open in IMG/M
3300012928|Ga0163110_11131782All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41627Open in IMG/M
3300012954|Ga0163111_10600525All Organisms → Viruses → Predicted Viral1028Open in IMG/M
3300013188|Ga0116834_1103604All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41595Open in IMG/M
3300017708|Ga0181369_1047442All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41969Open in IMG/M
3300017713|Ga0181391_1079694All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41749Open in IMG/M
3300017726|Ga0181381_1111583All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41575Open in IMG/M
3300017731|Ga0181416_1136579All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41590Open in IMG/M
3300017746|Ga0181389_1178500All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41555Open in IMG/M
3300017748|Ga0181393_1035231All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411409Open in IMG/M
3300017749|Ga0181392_1116744All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41791Open in IMG/M
3300017750|Ga0181405_1153340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41569Open in IMG/M
3300017752|Ga0181400_1187068All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41575Open in IMG/M
3300017763|Ga0181410_1066063All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411086Open in IMG/M
3300017771|Ga0181425_1233407All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41571Open in IMG/M
3300017776|Ga0181394_1182198All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41645Open in IMG/M
3300017786|Ga0181424_10058843All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411661Open in IMG/M
3300018049|Ga0181572_10871030All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41534Open in IMG/M
3300018416|Ga0181553_10359044All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41799Open in IMG/M
3300020175|Ga0206124_10344205All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41562Open in IMG/M
3300020176|Ga0181556_1040203All Organisms → Viruses → Predicted Viral2541Open in IMG/M
3300020342|Ga0211604_1118153All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41511Open in IMG/M
3300020376|Ga0211682_10323652All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41576Open in IMG/M
3300020381|Ga0211476_10034550All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED412162Open in IMG/M
3300020402|Ga0211499_10313872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37547Open in IMG/M
3300020433|Ga0211565_10125726All Organisms → cellular organisms → Bacteria → Proteobacteria1109Open in IMG/M
3300020445|Ga0211564_10007977All Organisms → cellular organisms → Bacteria5254Open in IMG/M
3300020446|Ga0211574_10397464All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41595Open in IMG/M
3300020448|Ga0211638_10055869Not Available1725Open in IMG/M
3300020454|Ga0211548_10662797Not Available508Open in IMG/M
3300020467|Ga0211713_10391875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37672Open in IMG/M
3300020471|Ga0211614_10110560All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411169Open in IMG/M
3300021347|Ga0213862_10204539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37695Open in IMG/M
3300021425|Ga0213866_10407031All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41663Open in IMG/M
3300021964|Ga0222719_10100288All Organisms → Viruses → Predicted Viral2117Open in IMG/M
3300022851|Ga0222691_1044927All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41598Open in IMG/M
3300022929|Ga0255752_10370746All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41576Open in IMG/M
3300025120|Ga0209535_1150275All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41735Open in IMG/M
3300025168|Ga0209337_1115414All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411221Open in IMG/M
3300025276|Ga0208814_1038502All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411464Open in IMG/M
3300025674|Ga0208162_1172000All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41574Open in IMG/M
3300025685|Ga0209095_1107862All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41864Open in IMG/M
3300025704|Ga0209602_1230320All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41528Open in IMG/M
3300025873|Ga0209757_10176889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37673Open in IMG/M
3300025886|Ga0209632_10203233All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300025889|Ga0208644_1285850All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41662Open in IMG/M
3300026204|Ga0208521_1016759All Organisms → cellular organisms → Bacteria → Proteobacteria2412Open in IMG/M
3300026265|Ga0208765_1119266Not Available664Open in IMG/M
3300027672|Ga0209383_1110580All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41905Open in IMG/M
3300027801|Ga0209091_10048512All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED412466Open in IMG/M
3300027813|Ga0209090_10221615All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41967Open in IMG/M
3300027838|Ga0209089_10062341All Organisms → Viruses → Predicted Viral2373Open in IMG/M
3300027838|Ga0209089_10289939All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41936Open in IMG/M
3300027847|Ga0209402_10330826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37940Open in IMG/M
3300027906|Ga0209404_10491362All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41811Open in IMG/M
3300028197|Ga0257110_1053415All Organisms → Viruses → Predicted Viral1755Open in IMG/M
3300029448|Ga0183755_1101510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37564Open in IMG/M
3300031519|Ga0307488_10365498All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41904Open in IMG/M
3300031596|Ga0302134_10070077All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411569Open in IMG/M
3300031598|Ga0308019_10066566All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411511Open in IMG/M
3300031627|Ga0302118_10212053All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41923Open in IMG/M
3300031675|Ga0302122_10153896All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41906Open in IMG/M
3300031695|Ga0308016_10155104All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41901Open in IMG/M
3300032073|Ga0315315_10690588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41936Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine29.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater12.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine10.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.00%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean2.00%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater1.00%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.00%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.00%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.00%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.00%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001419Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001953Marine microbial communities from Key West, Florida, USA - GS015EnvironmentalOpen in IMG/M
3300005401Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203EnvironmentalOpen in IMG/M
3300005520Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251EnvironmentalOpen in IMG/M
3300005914Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009601Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013188Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020342Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556117-ERR599036)EnvironmentalOpen in IMG/M
3300020376Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121)EnvironmentalOpen in IMG/M
3300020381Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620)EnvironmentalOpen in IMG/M
3300020402Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020445Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300020448Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020467Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022851Saline water microbial communities from Ace Lake, Antarctica - #1237EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025685Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026204Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 (SPAdes)EnvironmentalOpen in IMG/M
3300026265Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203 (SPAdes)EnvironmentalOpen in IMG/M
3300026270Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027838Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031598Marine microbial communities from water near the shore, Antarctic Ocean - #284EnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20158J14315_1022917413300001355Pelagic MarineMQRNFILTDVMKTGLHVELEEFVKMHTLEDQTFEMTGEYYTLHNYDLDSYDRRFAMIDSRQANVRVKDNPDFNVELKRRCELLH
JGI11705J14877_1014929023300001419Saline Water And SedimentMQRNFILTDVMKTGDHLNLEAFVNLHSLGNQSFDMTGEYYTLHDFDLDGYDRRFAVIDTRYSNERIHRNTEFNYELRRRCDLLHSQGFVFIKATPWES
JGI24006J15134_1005239113300001450MarineMKQRNFILTDIMKTGNHIQLEQFVMMHSLPDQTFDMTGEYYTLHNYDLDKYDRKFAIIDFRVANDRIADNKDFATELKKRCDLLH
JGI24003J15210_1003134043300001460MarineMQRNFILTDVMKTGFHGDLEDFISMHTLPNQQFEMTGEYYTLHHYDLDSYDRRFAIIDYRQANDEVDGAEFNAELDRRCKLLHSQGFVFIKACPW
GOS2231_103510243300001953MarineMKTGPHQDLEAFISLHSLKDQRFHYTGEYYTMHNYDIDAYDRKFAVIDVRAQNDRLKDNKEFHNELKRRCDLLHSQGFKFIKATPWES
Ga0066857_1013942723300005401MarineMQRNFILTDVMKTGNNSKLEDFINFHSLKGQAFDLAGEYYTLYNFDLDSYDRKFAIIDIREANNRLKDSAEFTAELKKRCKLLHSQGFVFIKAN
Ga0066864_1001410413300005520MarineMQRNFILTDVMKTGYHVDLEEFINMHSFPDQSFDITDEYYALHNYDLDSYDRRIAIIDYRYTNGRMHNNEEFISELDHRCKLLHSQGFHFIKATPWESMENIETMQPYPKI
Ga0075117_107732323300005914Saline LakeMKTGNHLKLEQFIDMHTIADQTFDMTGEYYTLHNYDLDSYDRKFAMIDVRGSNTRLKDNTEFKTELKKRCDLLHSQGFVFIKANPWESLENINT*
Ga0075461_1013367813300006637AqueousMQRNFILTDVMKTGNHADIEEFVNLHSIDDQNFTMTGEYYTLHSYDLDSFDRRFAVIDVRHENQRLKGNTEIQQELERRCELLRRQGFVFIKATPWESISN
Ga0098054_132447223300006789MarineMQRNFILTDVMKTGDHNSYEQFIDTHSLTDQTFEYTGEYYTLHQYDLEKYDRKFAVIDIRWANIEVKDNPDFKSELKRRCDLLHSQGFVFIKG
Ga0075476_1025813323300006867AqueousMKTGNHADIEEFVNLHSIDDQNFTMTGEYYTLHSYDLDSFDRRFAVIDVRHENQRLKGNTEIQQELERRCELLRSQGFVFIKATPWESISNIEECEADDIMFPKVNVE
Ga0098045_115511123300006922MarineMTLPSDTYFKNGVNIRVFIGYMQRNFILTDVMKTGDHVKMEQFIELHSLPDQIFDMTGQYYDLHNYDLDSYDRKFAMIDVRHINMSFKNNNEFQSELRKRCDLLH
Ga0075444_1031354313300006947MarineMQRNFILTDIMKTGFHIELENFISMHSMADQTFDMTGEYYTLQWHDLDSYDRKFAMLDVREGNARFANSTEFSTELKKRCDLLHSQGFVFIKTSPWESLENVNTAYDGLQY
Ga0099851_131385413300007538AqueousMKTGFHVKLEQFIGMHTLKDQSFDCTSEYYSLHNYDLDSYDRRFAIIDCREGNWLVIGDNKEFASELKRRCDLLHSQGFVFIK
Ga0102963_124036913300009001Pond WaterMKTGFHQELEQFINMNTLGEQQFDMTGEYYTLHNYDLDSYDRKFAIIDARLSNYRLKGNTEFDLELKKRC
Ga0114995_1066794623300009172MarineMKTGFHQNLENFISMHSMTDQTFDMTGEYYTLHNYDLDSYDRKFAIIDVRKENHKLKDNTEFEVELKKRCDLLHSQGFIFIKANPWESLDNINNSRQYPEID
Ga0115551_140054613300009193Pelagic MarineMKTGHTDNLTKFISMNTMTDQSFETTGEYYTLHNYDLDSFDRRFAIIDVRVNNIRFSCNDEFDSELRKRCELLKSQGFVFIKATPWESLHNIENTTS
Ga0115547_111907813300009426Pelagic MarineMKTGFHQNLENFISMHSMDNQTFDMTGEYFTLHNYDLDAYNRKFAIIDCRLENNRLKNNNEFLHELKRRCNLLHSQGFTFIKATPWESTENIKNSDL
Ga0115546_128739913300009435Pelagic MarineMQRNFILTDVMKTGFHQDLENFISMHSIKDQTFEMTGEYYSLHGYDLDSFDRKFAIIDTRTANFRLKDNEEFNTELERRCKLLHSQGFVFIKSNPW
Ga0115556_129026813300009437Pelagic MarineMKTGHTDNLTKFISMNTMTDQSFETTGEYYTLHNYDLDSFDRRFAIIDVRVNNIRFSCNDEFDSELRKRCELLKSQGFVFIKATPWESLHNIENTTSFNPLIGRQDTL
Ga0115557_121505913300009443Pelagic MarineMGHMQRNFILTDIMKTGDHIKLEQFINMHSLSDQTFDMTGEYYTLHNYDLDSYDRKFAMIDVRYQNERLKDNTEFKTELKKRCDLLHSQGFVFIK
Ga0115570_1047236913300009496Pelagic MarineMKTGHTDNLTKFISMNTMTDQSFETTGEYYTLHNYDLDSFDRRFAIIDVRVNNIRFSCNDEFDSELRKRCELLKSQGFVFIKATPWESLHN
Ga0115568_1024165613300009498Pelagic MarineMQRNFILTDVMKTGFHQDLENFISMHSIKDQTFEMTGEYYSLHGYDLDSFDRKFAIIDTRTANFRLKDNEEFNTELERRCKLLHSQGFVFIKSNPWESL
Ga0115564_1049850923300009505Pelagic MarineMKTGFHQNLENFIAMHTIADQTFDMTGEYYTLHNYDLDSYDRKFAMIDVSFQNVRVKGNTEFNTELKKRCDLLHSQGFMFIKANPWESLENINGGQYINDEFKFSNMPNYPEI
Ga0114914_107336623300009601Deep OceanMKTGDHVKLEQFINFHSLADQTFDLEGEYYTLHNYELDSYDRKFAIIDCRAQNDRLKGNTEFYSELRKRCDLLHSQGFVFI
Ga0115000_1036363913300009705MarineMKTGDHLELEKFIKFNSLGNQTFEMTGEYYTLHNYDLDSYDRKFAIIDVRHQNSRLKGNTEFNIELKKRCDLLHSQGFVFIKANPWESLENVNTNTQYPEIEI
Ga0115012_1048441023300009790MarineMKTGYHTRLEEFINMHSLKDQHFETTGEYYTLHNYDIDSYDRRFAIIDVRHSNDRLKENKEFNEELRRRCNLLHSQGFVFIKSNPWESLDNIKHVP
Ga0098061_102825513300010151MarineMQRNFILTDVMKTGNHLDLEDFIHMHTLKDQSFDCTGEYYILHNFDLDSYDRRIAIIDYRYTNGRMHNNEEFISELDHRCKLLHSQGFHFIKA
Ga0098059_110014513300010153MarineMKTGHHTNLESFISMNSIDDQTFDMTGEYYTLHNYDLDNYDRKFAILDVRHENVRLKDNAELNAELKKRCDLLHSQGFV
Ga0098059_114956413300010153MarineMQRNFILTDIMKTGNHNKLEDFINFHSLKDQSFEYTGEYYTLHNFDLDSYDRRFAIIDTRGANDRLKDSSNYIAELKKRCRLLHSQGF
Ga0129351_125657923300010300Freshwater To Marine Saline GradientMQRNFVLTDVMKTGNHQEIEEFIKMNSMKDQHFDMTGEYYTLHEYDLESYDRRFAVIDTRKANVRIHGNKEFDLELRRRCDLLHSQGFVFIKATPWE
Ga0129324_1022971413300010368Freshwater To Marine Saline GradientMQRNFILTDVMKTGFHENLEKFISMHSLPNQHFDMTGEYYMLHNYDLDRYDRKFAVIDIRWANIEVKDNPDFKSELKKRCDLLHSQGFVFIKATPWES
Ga0160422_1041909613300012919SeawaterMQQNFILTDVMKTGFHVDMEEFINLHSLHDQSFTMTGEYYTLHNYDLDVFDRKIAFIDRTKLYKTHPSHNPEFRKELDKRLSLLHSQGFKMIYTSPWESKQNIS
Ga0163110_1113178213300012928Surface SeawaterMKTGFHLDLEDFINMHTFPDQTFDMTGEYYTLHNYDLDSYDRRIAIIDYRYTNSRLHNNSEFIAELDKRCKLLHSQGFKFIKATPWESLDNVNNYR
Ga0163111_1060052513300012954Surface SeawaterMKTGNNSDFAKFISMNTMQGQTFDTTDEYYTLHNYDLDSYDRRFAVIDVRTDNVRFSINEDFNLELRKRCELLQSQGFVFIKATPWESIHNIENTKEFNPVI
Ga0116834_110360423300013188MarineMKTGLHTEIEHFISMHSFTDQQFDITGEYYTLHNYDLDSYDRKFAVIDVRHHNDRIKDNKDFHADLKRRCDLLHSQGFVFIKATPWESVEYVNYPWPSDYDLHPQIDI
Ga0181369_104744213300017708MarineMKTGNHVQLEQFINMHSLQDQTFDMTGEYYTLHNYDLDGYDRKFAMLDYNSSNARVANNPDFGPELKRRCALLHSQGFVFIKANPWESEDNLLLDPPEPQIDIKHMLWCGGVS
Ga0181391_107969423300017713SeawaterMQRNFILTDVMKTGYHLELEDFVSMNTLQDQEFEMTGEYYSLHNYDLDSYDRRFAIIDVRQANDRLKDNTEFHTELKKRCSLLHSQGFVFIKATPWESLENVENFA
Ga0181381_111158323300017726SeawaterMQRNFILTDIMKTGFHLEIEQFFSMHTLEDQSFDCTGEYYSLHNYDLDSYDRRFAIIDCRQANWNIIGKNEEFHAELKRRCDLLHSQGFTFIKASP
Ga0181416_113657923300017731SeawaterMKTGYHLELEDFVSMNTLQDQEFEMTGEYYSLHNYDLDSYDRRFAIIDVRQANDRLKDNTEFHTELKKRCSLLHSQGFVFIKATPWESLENVE
Ga0181389_117850013300017746SeawaterMQRNFILTDVMKTGFHGDLENFISMHSIPDQTFDMTGEYYMLHNYDLDRYDRKFAVIDIRWANIEVKDNPDFKSELKRRCDLLHSQG
Ga0181393_103523133300017748SeawaterMKTGNHLDLEEFINMNTLGGQKFEMTGEYYTLHNYDLDSYDRKFAIIDVRLHNDRLKGNTEFDLELKKRCDLLHSQGFKFIKATPWESVENVISSPQYPEID
Ga0181392_111674423300017749SeawaterMQRNFILTDVMKTGDHLDLEQFINMNTLTDQQFDMTGEYYSLHNYDLDSYDRRFAMIDVRQDNDRLKDNTEFYTELKRRCELLHS
Ga0181405_115334013300017750SeawaterMQRNFILTDVMKTGFHGDLENFISMHSIPDQTFDMTGEYYMLHNYDLDRYDRKFAVIDIRWANIEVKDNPDFKSELKRRCDLLHSQGFVFIKGTPWE
Ga0181400_118706823300017752SeawaterMQRNFILTDVMKTGYHTKLEQFIKMHTLDDQQFDLDGEYYSLHNYDLDSYDRKFAIIDVRRENHRLKDNAEFNTELQRRCKLLHSQGFVFIKSNPWESL
Ga0181410_106606323300017763SeawaterMQRNFILTDVMKTGYHLELEDFVSMNTLQDQEFEMTGEYYSLHNYDLDSYDRRFAIIDVRQANDRLKDNTEFHTELKKRCSLLHSQGFVFIKATPWESLD
Ga0181425_123340713300017771SeawaterMKTGYHLELEDFVSMNTLQDQEFEMTGEYYSLHNYDLDSYDRRFAMIDVRQDNDRLKDNTEFYTELKRRCELLHSQGFV
Ga0181394_118219813300017776SeawaterMKTGNHLDLEEFINMNTLGGQKFEMTGEYYTLHNYDLDSYDRKFAIIDVRLHNDRLKGNTEFDLELKKRCDLLHSQGFKFIKATPWESVENVISSPQYPEIDIEHFK
Ga0181424_1005884313300017786SeawaterMKTGYHLELEDFVSMNTLQDQEFEMTGEYYSLHNYDLDSYDRRFAIIDVRQANDRLKDNTEFHTELKKRCSLLHSQGLVFIKATPWES
Ga0181572_1087103013300018049Salt MarshMQRNFILTDVMKTGFHVDLEDYIHMNTFTDQTFDMTGEYYTLHNFDLDAYDRRFAIIDYRVSNLRFEHNNEFNTELQKRCDLLHSQGFKFIKA
Ga0181553_1035904423300018416Salt MarshMQRNFILTDVMKTGYHLDLEQFINMNTLGGQHFEMTGEYYTLHNYDLDSYDRKFAMIDVRATNDRLKDNMEFNLELRRRCDLLHSQGFKLIKTAPWESLDNFRS
Ga0206125_1011321713300020165SeawaterMKTGDHRKLEQFINMHSLPDQTFDMSGEYYTLHNYDLDNYDRKFAMVDCRFVNARLKDNTEFNTELKKRCNLLHSQGFVFIKSTPWE
Ga0206124_1034420523300020175SeawaterMQRNFILTDIMKTGNHQHIENFISMHSMADQSFDMTGEYYTLHNYDLDSYDRKFAMIDVRHENMPFKDNKEFHSELRKRCNLLHSQGFVFIK
Ga0181556_104020313300020176Salt MarshMQRNFILTDIMKTGPHQQLEQFVNLHSIADQTFDMTGEYFTLHDFDLDSYDRKFAILDCRKVNRSFEKNKEYSIELNRRCDLLHSQGFNFIKATPWESLENVNAETQYPD
Ga0211604_111815323300020342MarineMQRNFILTDIMKSGYHLDLENFINHHTLPNQSFDMTGEYFSLHNYDLDTYDRKFAVIDCRTANAGLAFNPEYDDTLKHRVKLLHSQGFVFIKATP
Ga0211682_1032365223300020376MarineMKTGNHVKLEQFINFHSLADQTFDLEGEYYTLHNYELDSYDRKFAIIDCRAQNDRLKGNTEFYSELRKRCDLLHSQGFVFIKAN
Ga0211476_1003455043300020381MarineMKTGFHVELEQFINMHSLSNQEFEMTGEYYTLHNYDLDSYDRRFAIIDVRGDNLRLKDNSEFNEELKRRCELLHSQGFVFIKSNPWESHENINS
Ga0211499_1031387213300020402MarineMQRNFILTDVMKTGNHQQLEQFINFHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAIIDCRAENVRFKGNNELKKELKKRCDLLHSQGFVFIKATPWESLQNLTYHKQYPE
Ga0211565_1012572623300020433MarineVQMQRNFILTDVMKTGNHQQLEQFINFHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAIIDCRAENVRFKGNIELKKELKKRCDLLHSQGFVFIKATPWESLQNLTYHKQ
Ga0211564_10007977103300020445MarineMQRNFILTDVMKTGYHVDLEEFINMHSFPDQSFDMTGEYYTLHNYDLDSYDRRIAIIDYRYTNDRIHNNKEFIGELDHRCKLLHSQGFHFIKATPWES
Ga0211564_1067045623300020445MarineMHTLKDQSFECTGEYYTLHNFNIDSYDRRFAIIDTRIANDRLKDNKEFHEELQRRCDLLHSQGFVFIKANPW
Ga0211574_1039746413300020446MarineMQRNFILTDVMKTGFHNDLEDFINMHSLPNQRFDMTGEYYTLHHYDLDSYDRRFAIIDYRPANDEFDGAEFNAELDRRCKLLHSQGFVFIKACPW
Ga0211638_1005586913300020448MarineMQSNFILTDVMKTGFHLDLEEFIRLNSLSDQTFDMAGEYYTLHQYDLDSYDRKFAIIDWRYDNHRVAQNKEFNDELSRRIKLLHSQGF
Ga0211548_1066279713300020454MarineMQHNFILTDVMKTGNHVDLEQFINMHTLQKQKFDMTGEYYTLHQYNLDSYDRKFAILDCREGNFRIKDNPDFAQELTKRCKLLHSQGFVFIK
Ga0211713_1039187513300020467MarineMQSNFILTDVMKTGFHLDLEEFIKLNSLSDQIFDMAGEYYTLHQYDLDSYDRKFAIIDWRYDNHRVAQNKEFNDELSRRIKLLHSQGFIFIKSN
Ga0211614_1011056033300020471MarineMQRNFILTDVMKTGDHVKLEQFISSHSLPDQSFEMTGEYYTLHNYDLDSYHRKFAIIDCGMHNRTIANNENFIQELKQRCDLLHSQGFVFIKATP
Ga0213862_1020453913300021347SeawaterMQRNFILTDVMKTGFHVELEQFINTHTMADQQFDMTGEYYSLHNYDLDSYDRKFAIIDVRRANHRLKDNKEFNSELKKRCDLLHSQGFVFIKATPWESLENTKHTPQYP
Ga0213866_1040703123300021425SeawaterMQRNFILTDVMKTGFHQDLENFISMHSIKDQTFEMTGEYYSLHGYDLDSFDRKFAIIDMRTANIRLKDNEEFNTELERRCKLLHSQGFVFIKSNPWESLENINNTVQYPEIE
Ga0222719_1010028853300021964Estuarine WaterMKTGFHTELEQFIDMHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAMIDVRYQNERLKDNTEFNTELKKRCDLLHSQGFVFIKAIP
Ga0222691_104492723300022851Saline WaterMQRNFILTDVMKTGFHQDLENFIAMHTIADQTFDMTGEYYTLHNYDLDSYDRKFAMIDVRYQNVRLKDNKEFNTELKKRCDLLHSQGFVFIKATPWESLENVNATYDV
Ga0255752_1037074613300022929Salt MarshMQRNFILTDVMKTGYHLDLEQFINMNTLGGQHFEMTGEYYTLHNYDLDSYDRKFAMIDVRATNDRLKDNMEFNLELRRRCDLLHSQGFKLIKTAPWESLDNFRSS
Ga0209535_115027523300025120MarineMTLPSDTYFKKGVNINVFIGQMQRNFILTDIMKTGDHLELEKFIKFNSLGNQTFEMTGEYYTLHNYDLDSYDRKFAIIDVRHQNSRLKGNTEFNIELKKRCDLLHSQGFVFIKAN
Ga0209337_111541413300025168MarineMQRNFILTDIMKTGDHLELEKFIKFNSLGNQTFEMTGEYYTLHNYDLDSYDRKFAIIDVRHQNSRLKGNTEFNIELKKRCDLLH
Ga0208814_103850233300025276Deep OceanMQRNFILTDVMKTGNHLKLEQFINFHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAIIDCRAENSRLKDNTEFYSELRKRCDLLHSQGFIF
Ga0208162_117200013300025674AqueousMQRNFILTDVMKTGFHVKLEQFIGMHTLKDQSFDCTSEYYSLHNYDLDSYDRRFAIIDCREGNWLVIGDNKEFASELKRRCDLLHSQGFVFIKATPWESLQNLEST
Ga0209095_110786213300025685Pelagic MarineMKTGFHQNLENFISMHSMDNQTFDMTGEYFTLHNYDLDAYNRKFAIIDCRLENNRLKNNNEFLHELKRRCNLLHSQGFTFIKATPW
Ga0209602_123032013300025704Pelagic MarineMQRNFILTDVMKTGNHQELENFIAMHTIADQTFDMTGEYYTLHNYELDRYDRKFAIIDVSFQNVRVKGNTEFKTEL
Ga0209757_1017688923300025873MarineMQRNFILTDIMKTGNHNKLEDFINLHSLKGQAFDFTGEYYTLHNFNLDSYDRKFAIIDIRGANDRIKDSPEFIAELEKRCKLLHSQGFVFIKANPWESLEN
Ga0209632_1020323323300025886Pelagic MarineMKTGLHVELEEFVKMHTLEDQTFEMTGEYYTLHNYDLDSYDRRFAMIDSRQANVRVKDNPDFNVELKRRCELLHSQGFVFIKADPWESQDNIKQI
Ga0208644_128585013300025889AqueousMQRNFILTDVMKTGYHTQLEAFVNSHSLKSQKFDMTGEYYTLHEYDLESYDRRFAVIDTRKANIRIHGNTEFDLELRRRCDLLHSQGFVFIKATPWESIH
Ga0208521_101675913300026204MarineMQRNFILTDVMKTGNNSKLEDFINFHSLKGQAFDLAGEYYTLYNFDLDSYDRKFAIIDIREANNRLKDSAEFTAELKKRCKLLHSQGFVFIKANPWESLENI
Ga0208765_111926623300026265MarineMQRNFILTDVMKTGNNSKLEDFINFHSLKGQAFDLAGEYYTLYNFDLDSYDRKFAIIDIREANNRLKDSAEFTAELKKRCKLLHSQGFV
Ga0207993_112485923300026270MarineMQRNFILTDVMKTGLHTEIEHFISMHSFTDQQFDITGEYYTLHNYDLDSYDRKFAVIDVRHHNDRIKDNKDFHADLKRRCDLL
Ga0209383_111058023300027672MarineMKTGNHVKLEQFINFHSLADQTFDLEGEYYTLHNYELDSYDRKFAIIDCRAQNDRLKGNTEFYSELRKRCDLL
Ga0209091_1004851253300027801MarineMQRNFILTDIMKTGNHPKLEQFIDFHSLSDQTFDMTGEYYTLHSYDLDNYDRKFAVIDCRDLNIRIKDNAEFITELKKRCDLLHS
Ga0209090_1022161533300027813MarineMQRNFILTDVMKTGNHGKLEQFISYHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAMIDVRHQNDRLKDNTEFNTELKKRCDLLH
Ga0209089_1006234113300027838MarineMQRNFILTDVMKTGNHIKLEQFISYHSLPDQNFDMTGEYYTLHNYDLDSYDRKFAVIDCRIQNDRVADNTDFNTELKKRCDLLHSQGFVFIKANPWESLDNVNSIQ
Ga0209089_1028993913300027838MarineMKTGNHGKLEQFISYHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAIIDYRLQNVRVADNTDFNTELKKRCDLLHSQGFV
Ga0209402_1033082623300027847MarineMQRNFILTDVMKTGNHNKLEDFINFHSLKDQLFDYTGEYYTLHNFDLDSYDRKFAIIDIRKANVRLKDSAEFTVELEKRCKLLHSQGFVFIKANPWESLENVNN
Ga0209404_1049136213300027906MarineMQRNFILTDVMKTGYHVDLEEFINMHSFPDQSFDMTGEYYTLHNYDLDSYDRRIAIIDYRYTNDRIHNNKEFIRELDHRCKLLHSQGFHFI
Ga0228674_127097913300028008SeawaterMKTGDHLDLEQFINMNTLTDQQFDMTGEYYSLHNYDLDSYDRRFAMIDVRQDNDRLKDNTEFYTELKRRCELLH
Ga0257110_105341533300028197MarineMKTGYHVELEQFINLNSLADQTFDLEGEYYTLHNYDLDSYDRKFAIIDCRAQNDRLKDNTEFYSELRKRCDLLHSQGFIFIKSNPWE
Ga0183755_110151013300029448MarineMQTNFILTDVMKTGYHQDLEQFITMNTMQDQRFTFTGEYYTLHNYDLDSYDRRFAIIDTRYTNIRLKDSDAFNEELRKRCELLHSQGFVFIKANPWESLE
Ga0307488_1036549813300031519Sackhole BrineMQRNFILTDIMKTGFHQNLENFIAMHTIADQTFDMTGEYYTLHNYDLDSYHRKFAMIDTRGVNVRLKDNTEFNTELKKRCDLLHSQ
Ga0302134_1007007733300031596MarineMKTGIHTDLEQFIDMHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAIIDCRAQNNRLKDNTEFYSELRKRCDLLHSQGFVFIKASPWESL
Ga0308019_1006656613300031598MarineMQRNFILTDIMKTGFHQNLENFIAMHTIADQTFDMTGEYYTLHNYDLDSYDRKFAMIDVRYQNDRLKDNKEFNTELKKRCDLLHSQGFVFIKATPWESLENVNSTYNGLQ
Ga0302118_1021205313300031627MarineMQRNFILIDIMKTGDHTKLEQFINLHSLADQTFDLEGEYYTLHNYDLDSYDRKFAIIDCRAQNDRLKDNTEFYSELRKRCDLLHSQGFVFIKANPWESLDNI
Ga0302122_1015389623300031675MarineMQRNFILTDVMKTGNHGKLEQFISYHSLPDQTFDMTGEYYTLHNYDLDSYDRKFAMIDVRHQNDRLKDNTEFNTELKKRCDLLHSQGFIFIKASPWESLD
Ga0308016_1015510413300031695MarineMQRNFILTDVMKTGYHVELEQFINLHSLADQTFDLEGEYYTLHNYDLDSYDRKFAIIDCRAQNDRLKDNTEFYSELRKRCDLLHSQGFIFIKSNPWESLE
Ga0315315_1069058813300032073SeawaterMQRNFILTDVMKTGFHGDLENFISMHSIPDQTFDMTGEYYMLHNYDLDRYDRKFAVIDIRWANIEVKDNPDFKSELKRRCDLLHSQGFVFIKGTPWESLENIKNSHIDYHQYP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.