NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F106138

Metagenome / Metatranscriptome Family F106138

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106138
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 39 residues
Representative Sequence DALAKLLIEKGLITREEFMEKISEERATYQKLLNPTPQ
Number of Associated Samples 71
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.11 %
% of genes near scaffold ends (potentially truncated) 74.00 %
% of genes from short scaffolds (< 2000 bps) 85.00 %
Associated GOLD sequencing projects 67
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(15.000 % of family members)
Environment Ontology (ENVO) Unclassified
(28.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.91%    β-sheet: 0.00%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF09851SHOCT 3.00
PF02518HATPase_c 3.00
PF00072Response_reg 2.00
PF00903Glyoxalase 2.00
PF04972BON 2.00
PF05494MlaC 2.00
PF00589Phage_integrase 1.00
PF16864Dimerisation2 1.00
PF00528BPD_transp_1 1.00
PF00248Aldo_ket_red 1.00
PF01381HTH_3 1.00
PF01594AI-2E_transport 1.00
PF13884Peptidase_S74 1.00
PF12681Glyoxalase_2 1.00
PF09594GT87 1.00
PF08241Methyltransf_11 1.00
PF13676TIR_2 1.00
PF11295DUF3096 1.00
PF03062MBOAT 1.00
PF13592HTH_33 1.00
PF05016ParE_toxin 1.00
PF04392ABC_sub_bind 1.00
PF00496SBP_bac_5 1.00
PF01063Aminotran_4 1.00
PF00891Methyltransf_2 1.00
PF01541GIY-YIG 1.00
PF13191AAA_16 1.00
PF03401TctC 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 2.00
COG2854Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 2.00
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.00
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.00
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.00 %
UnclassifiedrootN/A45.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100440261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Chroococcidiopsis → unclassified Chroococcidiopsis → Chroococcidiopsis sp. FACHB-1243887Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101586005Not Available671Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105295309Not Available1084Open in IMG/M
3300000550|F24TB_10326582All Organisms → cellular organisms → Bacteria → Proteobacteria564Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10036326All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10037242All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10107760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300000955|JGI1027J12803_104260318Not Available1124Open in IMG/M
3300000955|JGI1027J12803_104819841Not Available559Open in IMG/M
3300000955|JGI1027J12803_107465827Not Available584Open in IMG/M
3300000955|JGI1027J12803_108632613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium980Open in IMG/M
3300000956|JGI10216J12902_101060947Not Available3165Open in IMG/M
3300000956|JGI10216J12902_111938041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium940Open in IMG/M
3300000956|JGI10216J12902_112739078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1042Open in IMG/M
3300000956|JGI10216J12902_120268932Not Available518Open in IMG/M
3300001431|F14TB_100037289Not Available804Open in IMG/M
3300002124|C687J26631_10180073Not Available705Open in IMG/M
3300005174|Ga0066680_10023058All Organisms → cellular organisms → Bacteria3430Open in IMG/M
3300005518|Ga0070699_100410620Not Available1225Open in IMG/M
3300005713|Ga0066905_100055874All Organisms → cellular organisms → Bacteria2448Open in IMG/M
3300005713|Ga0066905_100949551Not Available755Open in IMG/M
3300005764|Ga0066903_100856716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1636Open in IMG/M
3300005764|Ga0066903_105344078Not Available678Open in IMG/M
3300005764|Ga0066903_108393821Not Available527Open in IMG/M
3300005937|Ga0081455_10300062All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300006034|Ga0066656_10238773All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300006058|Ga0075432_10243167Not Available728Open in IMG/M
3300006844|Ga0075428_100898427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium939Open in IMG/M
3300006844|Ga0075428_101506626All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300006845|Ga0075421_100364041All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300006845|Ga0075421_102511341All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006846|Ga0075430_100793999All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300006847|Ga0075431_102011200All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300006852|Ga0075433_11364885Not Available613Open in IMG/M
3300006871|Ga0075434_100292541Not Available1649Open in IMG/M
3300006871|Ga0075434_100318797All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300006904|Ga0075424_100338019All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300006969|Ga0075419_11306452Not Available539Open in IMG/M
3300009012|Ga0066710_101132916All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300009081|Ga0105098_10716236Not Available533Open in IMG/M
3300009094|Ga0111539_12216646Not Available637Open in IMG/M
3300009100|Ga0075418_10757615All Organisms → cellular organisms → Bacteria → Proteobacteria1048Open in IMG/M
3300009137|Ga0066709_101261090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1086Open in IMG/M
3300009137|Ga0066709_103842707All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009157|Ga0105092_10024159All Organisms → cellular organisms → Bacteria3199Open in IMG/M
3300010043|Ga0126380_10230643All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300010046|Ga0126384_10555610All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300010046|Ga0126384_11127234Not Available720Open in IMG/M
3300010046|Ga0126384_11186970All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla703Open in IMG/M
3300010358|Ga0126370_10500043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1027Open in IMG/M
3300010358|Ga0126370_11448250All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300010360|Ga0126372_11068639Not Available823Open in IMG/M
3300010361|Ga0126378_10015235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00176462Open in IMG/M
3300010361|Ga0126378_10104240All Organisms → cellular organisms → Bacteria2806Open in IMG/M
3300010362|Ga0126377_10996851Not Available904Open in IMG/M
3300010362|Ga0126377_11722751All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300010366|Ga0126379_11318546All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300011112|Ga0114947_10020067All Organisms → cellular organisms → Bacteria3349Open in IMG/M
3300012022|Ga0120191_10011943Not Available1099Open in IMG/M
3300012205|Ga0137362_10349572All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1280Open in IMG/M
3300012205|Ga0137362_10817273Not Available798Open in IMG/M
3300012205|Ga0137362_11229232All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium ST_bin12634Open in IMG/M
3300012226|Ga0137447_1063577Not Available690Open in IMG/M
3300012349|Ga0137387_10864950All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012354|Ga0137366_10037778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3739Open in IMG/M
3300012357|Ga0137384_10280973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1386Open in IMG/M
3300012360|Ga0137375_10756585Not Available787Open in IMG/M
3300012532|Ga0137373_11169962Not Available545Open in IMG/M
3300012582|Ga0137358_10288867Not Available1114Open in IMG/M
3300012930|Ga0137407_10918351Not Available828Open in IMG/M
3300012948|Ga0126375_10716635All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300012948|Ga0126375_11070925Not Available662Open in IMG/M
3300012986|Ga0164304_11230332All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300015373|Ga0132257_104401212Not Available513Open in IMG/M
3300016294|Ga0182041_11975404Not Available543Open in IMG/M
3300018053|Ga0184626_10001935All Organisms → cellular organisms → Bacteria7472Open in IMG/M
3300018054|Ga0184621_10202060Not Available712Open in IMG/M
3300018072|Ga0184635_10008614All Organisms → cellular organisms → Bacteria3467Open in IMG/M
3300018072|Ga0184635_10381338All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300018072|Ga0184635_10391115Not Available528Open in IMG/M
3300018081|Ga0184625_10308598Not Available826Open in IMG/M
3300018482|Ga0066669_10196360Not Available1540Open in IMG/M
3300020230|Ga0212167_1024993All Organisms → cellular organisms → Bacteria3478Open in IMG/M
3300025910|Ga0207684_10815361Not Available788Open in IMG/M
3300026328|Ga0209802_1162398Not Available926Open in IMG/M
3300026537|Ga0209157_1266532All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300027646|Ga0209466_1000532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00177929Open in IMG/M
3300027654|Ga0209799_1018455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium1526Open in IMG/M
3300027722|Ga0209819_10201102Not Available694Open in IMG/M
3300027722|Ga0209819_10340084Not Available514Open in IMG/M
3300030990|Ga0308178_1134284All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031720|Ga0307469_10611997All Organisms → cellular organisms → Bacteria → Proteobacteria975Open in IMG/M
3300031820|Ga0307473_10331332All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes971Open in IMG/M
3300031908|Ga0310900_10865894Not Available735Open in IMG/M
3300032205|Ga0307472_100050018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2597Open in IMG/M
3300032261|Ga0306920_100097027All Organisms → cellular organisms → Bacteria4361Open in IMG/M
3300033814|Ga0364930_0334920Not Available508Open in IMG/M
3300034149|Ga0364929_0222824Not Available629Open in IMG/M
3300034354|Ga0364943_0173681Not Available784Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil15.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere14.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.00%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Sediment1.00%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.00%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011112Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaGEnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020230Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10044026113300000364SoilLAKLLIEKGIVRQEAIMENISEERATYQKVLNPTSQ*
INPhiseqgaiiFebDRAFT_10158600513300000364SoilAKLLIEKYLITREEFMQKLSEERATYQRLLNLTPQ*
INPhiseqgaiiFebDRAFT_10529530923300000364SoilLLVSSLAQTDALANLMIEKGLIRREEFMQMISEERATYQKLFDTTPQ*
F24TB_1032658213300000550SoilAQTDALAKLLIEKELVTREEFMQKVSEERATYQKLFNPTRH*
AF_2010_repII_A001DRAFT_1003632613300000793Forest SoilQTDALAELLIEKGLITREEFMQKISEERATYQKMLNPTPQ*
AF_2010_repII_A001DRAFT_1003724223300000793Forest SoilLAKLLIEKGLITREEFMQKISKERATYQKLLKPTSH*
AF_2010_repII_A001DRAFT_1010776013300000793Forest SoilAQTDALAKLLIEKGLITRDEFMQKIAKERATYQKLLNPTAQ*
JGI1027J12803_10426031853300000955SoilIRYAGRITKLLIEKGLITQEEFMEKLCSERATYQKLLNPTQQ*
JGI1027J12803_10481984113300000955SoilAQTDALAKLLIEKGLITREEFMQKISKERATYQKLFNPTRQ*
JGI1027J12803_10746582713300000955SoilMGRCTGEIEKGLITREDFMQKISEERATYQKLLNP
JGI1027J12803_10863261333300000955SoilDALAKLLIEKGLITREAFMQKISEERTVYQKLLNPTVQ*KV
JGI10216J12902_10106094743300000956SoilQTDALAKLLIEKGLITREEFMQRISEERATYRTLLNPTPQ*
JGI10216J12902_11193804123300000956SoilMVDAVTKLLIEKGVISEEEFTEKLMEERATYQKILNPAPQ*
JGI10216J12902_11273907823300000956SoilMADALVKLLIENGIIAQDEFVRKLSEERATCLRLLNPTQQ*
JGI10216J12902_12026893223300000956SoilLAKLLIDKGIITKQEFLAKISEERATYQQLFNPTPQ*
F14TB_10003728923300001431SoilTDALAKLLIEKGLITQKIPQERATYQKLLNPTPQ*
C687J26631_1018007313300002124SoilCLAHTDALARLLIDKGVINQQEFLQKISEERATYQKLFNSTPQ*
Ga0066680_1002305863300005174SoilTDALAKLLIEKGLITREEYMAKLSAERAVYQKLLNPTPQ*
Ga0070699_10041062013300005518Corn, Switchgrass And Miscanthus RhizosphereVQSDALSKLLIEKGVITNQEFLAKISEERATYQQLFNPTPQ*
Ga0066905_10005587413300005713Tropical Forest SoilLRRLDALAKLLIEKGLISPEEFMQKISEERATYQKLLNPTRQ*
Ga0066905_10094955113300005713Tropical Forest SoilDALAKLLIDKGLITREEFMQKISEERATYQKLLNPTPQ*
Ga0066903_10085671623300005764Tropical Forest SoilMLAKLLIEKGLITREDFMQKISEERATYQELLKPTPQ*
Ga0066903_10534407823300005764Tropical Forest SoilDALAKLLIEKGLITREEFMEKISEERATYQKLLNPTPQ*
Ga0066903_10839382123300005764Tropical Forest SoilKLLIEKGLITREEFMQKISEERATYQRLLNPTAQ*
Ga0081455_1030006223300005937Tabebuia Heterophylla RhizosphereMAKLLIEKGLITQEEFMQKISDEPATDQRLLNPILQ*
Ga0066656_1023877313300006034SoilAVTKLLIEKGLITEAEFKEKLLQERAVYQKLLNPTVQ*
Ga0075432_1024316713300006058Populus RhizosphereQTDALAKLLIEKGVITREEFMQKISEERATYQKLFNPTHQ*
Ga0075428_10089842713300006844Populus RhizosphereKLLIEKGLITREEFMQKISEERATYQKLLNLTTPINIGE*
Ga0075428_10150662613300006844Populus RhizosphereLSQASRQTDAPAKLLIEKGVITRDEFMQTISEDRPTYQKF
Ga0075421_10036404133300006845Populus RhizosphereTDALAKLLIEKGLITREEFMQKISEERATYQKLFNPTPQ*
Ga0075421_10251134113300006845Populus RhizosphereMADALVKLLIENGIIAQDEFVRKLSEERATYLRLLNPTQQ*
Ga0075430_10079399913300006846Populus RhizosphereKLLIEKGLITRDEFMQKISVERATYQKLLTQTPQ*
Ga0075431_10201120023300006847Populus RhizosphereRRTLAKLLIEKGLITREEFMQKISEERATYQKLLNQTPQ*
Ga0075433_1136488523300006852Populus RhizosphereLAQTDALTKLLIEKGLIAQEEFMEKLSQERATYQKLLNPTRQ*
Ga0075434_10029254133300006871Populus RhizosphereDALAKLLIEKGLITREEFMLKISEERATYQRLLNSTVQ*
Ga0075434_10031879713300006871Populus RhizosphereTDALAKLLIEKGLITREEFIQKISEERGTYQKLLNPTQQ*
Ga0075424_10033801953300006904Populus RhizosphereDASKPLIEKGLITREEFMQKISEERATYQRLLNPLPQ*
Ga0075419_1130645223300006969Populus RhizosphereDALTKLLIEKGLIAQEEFMEKLSQERATYQKLLNPTRQ*
Ga0066710_10113291633300009012Grasslands SoilAKLLIEKGMITRDEYMKKLATERAAYQKLFNPTVQ
Ga0105098_1071623623300009081Freshwater SedimentINFGNAVTQLLIEKGVISEEEFREKLMEERATYQKILNPTQQ*
Ga0111539_1221664613300009094Populus RhizosphereLARLLIQKGLIRREEFMQKISEERATYLKLLNPTSQ*
Ga0075418_1075761543300009100Populus RhizosphereAKLLIEKGLITRDEFMRKISEERATYQKLLNPTPR*
Ga0066709_10126109013300009137Grasslands SoilDALAKLLIEKGLITRDEYMEKLYTERAAYQKLFNPTVQ*
Ga0066709_10384270723300009137Grasslands SoilQTDALAKLLIEKGLITRDEYMDKLSTERAAYQKLFNPTVQ*
Ga0105092_1002415943300009157Freshwater SedimentMVDAVTKLLIEKGIISEEEFKEKLSEERATYQKLFNPTQQ*
Ga0126380_1023064313300010043Tropical Forest SoilMLAKLLIEKGLITREEFMQKISEERATYQKLLKPTPH*
Ga0126384_1055561013300010046Tropical Forest SoilDALAKLLIEKGLINREEFMQKISEARATYQRLLNPTPQ*
Ga0126384_1112723413300010046Tropical Forest SoilAKLLIEKGLITQEEFSQKLAAERATYQKLFDPTPH*
Ga0126384_1118697023300010046Tropical Forest SoilVKLLIEKGLITREEFMQKISEERVTYQKLLNPTSH*
Ga0126370_1050004323300010358Tropical Forest SoilMHWRSFLIEKGLITRDEFMQKIAKERATYQKLLNPTAQ*
Ga0126370_1144825023300010358Tropical Forest SoilVFAQTDALAKLLIEKGLITREDFMQKILEERATYKKLLNPIPQ*
Ga0126372_1106863913300010360Tropical Forest SoilLAKLLIEKGLITRQEFMQKISEERATYQRLLNPLPQ*
Ga0126378_1001523563300010361Tropical Forest SoilSSQALTRIDLLAKLLIEKKLISQEEFMQKISEERATYRKLLNPTLQ*
Ga0126378_1010424013300010361Tropical Forest SoilMLTKLLIEKGLITREEFMQKISEERATYQKLLHPTLQ*
Ga0126377_1099685123300010362Tropical Forest SoilALAKLLIEKGLIIGEEFMRKISEERATSQKLLHPTRQ*
Ga0126377_1172275113300010362Tropical Forest SoilQTDALAKVLIEKGLITREEFMQKISEERATYQKLLKPRVQ*
Ga0126379_1131854613300010366Tropical Forest SoilMLAKLLIEKELITREEFMQRISEERVTYQKLLKPTSL*
Ga0114947_1002006733300011112Deep SubsurfaceVAKLLIEKGVITQDEFMEKIKAERAAYQELLKTIR*
Ga0120191_1001194333300012022TerrestrialMADALAKLLIEKGLITQEEFMQNISEERATYQKLFNPTPQ*
Ga0137362_1034957213300012205Vadose Zone SoilLAKLLIEKGMITREEFMQKISEERGTYQKLLNPTPQ*
Ga0137362_1081727333300012205Vadose Zone SoilQTDALAKLLSEKGLITREEFMQMISEERATYQKLLNPTQQ*
Ga0137362_1122923213300012205Vadose Zone SoilALAKLLIEKGLITREEFMQKISEERGTYQKLLNPTPQ*
Ga0137447_106357733300012226SoilSCLAHTDALARLLIDKGVIKQQEFLQKISGERATYQKLFNPTPQ*
Ga0137387_1086495023300012349Vadose Zone SoilSDALAKLLIEKGLITRDEYIEKLSAERAVYQKLLNFTVQ*
Ga0137366_1003777873300012354Vadose Zone SoilLAQGDALAKLLIEKGLITHDEYTEKLSTERAAYQKLFNPTVQ*
Ga0137384_1028097343300012357Vadose Zone SoilAVTKLLIEKGVITEAEFKEKLLQERAVYQKLFNPTVQ*
Ga0137375_1075658533300012360Vadose Zone SoilMGLLIEKGLIAREEFMQKISEERATYQKLLNPTPQ*
Ga0137373_1116996213300012532Vadose Zone SoilLAKLLIEKGPITREEFMQKISEERATYQKLLNPAPQ*
Ga0137358_1028886743300012582Vadose Zone SoilDALAKLLIEKGLITREEFMQRISEDRATYQKLLNPMPQ*
Ga0137407_1091835123300012930Vadose Zone SoilMLLIEKGLITREEFMEKISEERATYQKLFNPTQQ*
Ga0126375_1011282113300012948Tropical Forest SoilKLLIEKGLITQDEFSQKLAAEQATYQKLLSHKPQ*
Ga0126375_1071663523300012948Tropical Forest SoilKLLIEKELITREEFMQRISEERVTYQKLLKPTSL*
Ga0126375_1107092513300012948Tropical Forest SoilQTDALARLLIEKGLITREEFMQKISEERATYQTMLNPTPQ*
Ga0164304_1123033213300012986SoilQIDALAKLLIEKGLIAREEFLQKISEERATYQNLITD*
Ga0132257_10440121223300015373Arabidopsis RhizosphereLAKLLIEKGLITREEFMQEISDERATYQNLMNPTPQ*
Ga0182041_1197540413300016294SoilAKLLIEKGVITREEFMQKILEERATYQKLLKPAPQ
Ga0184626_1000193573300018053Groundwater SedimentVLVDLSKLLIEKGLITQEEFMQKISEERATYQKILNPTQQ
Ga0184621_1020206023300018054Groundwater SedimentIEKGIISQQEFLAKISEERATYQRMLNPMKQXWEGV
Ga0184635_1000861433300018072Groundwater SedimentLGKLLIEKGLITREEFMRRISEERATYQNLLNPTRQ
Ga0184635_1038133813300018072Groundwater SedimentAQTDALAMLLIEKRLITREEFMQEISEERATYQKLFSPTPQ
Ga0184635_1039111523300018072Groundwater SedimentMHLAKLLIEKGLITQEEFMEKISEERATYQKLFNPTPQ
Ga0184625_1030859823300018081Groundwater SedimentMVDAVTKLLIEKGVISEEEFKQKLMEERATYQKILNPTPQ
Ga0066669_1019636023300018482Grasslands SoilAQSDALAKLLIEKGLITRDEYMQKLATERAAYQELFNPAVQ
Ga0212167_102499333300020230SedimentVAKLLIEKGVITQDEFMEKIKAERAAYQELLKTIR
Ga0207684_1081536113300025910Corn, Switchgrass And Miscanthus RhizosphereEALARLLIEKGVITQREFLQKIAEERATYQKLPKPTVQ
Ga0209802_116239813300026328SoilAKLLIEKGLITREEYMAKLSAERAVYQKLLNPTPQ
Ga0209157_126653223300026537SoilLAQGDALAKLLIEKGLITRDEYMEKLATERAAYQKLFNPTVQ
Ga0209466_100053273300027646Tropical Forest SoilLAKLLIEKKLISQEEFMQKISEERATYRKLLNPTLQ
Ga0209799_101845513300027654Tropical Forest SoilLVSSLTQNDALAKLLIEADYPRKFMQKISEERATYQKMLNPTPQ
Ga0209819_1020110233300027722Freshwater SedimentVDAVTKLLIEKGLLSEEEFREKLMEERATYQKILNPTPQ
Ga0209819_1034008413300027722Freshwater SedimentMVDAVTKLLIEKGIISEEEFKEKLSEERATYQKLFNPTQQ
Ga0308178_113428423300030990SoilPAKLLIEKGLITREEFMQKISEERAMYQKLLNPTPQ
Ga0307469_1061199733300031720Hardwood Forest SoilLGKAEDEPFLEKGLITREELMQKISEERGTYRKLLNPTPHE
Ga0307473_1033133213300031820Hardwood Forest SoilLAKLQIEKGLITREEFMQKISEDRATYQKLLNPTRQ
Ga0310900_1086589413300031908SoilTDALAKLLIEKGLITREEFMQEISDERATYQNLMNPTPQ
Ga0307472_10005001813300032205Hardwood Forest SoilAQTDALAKLLIEKGLITREEFMEKISEEQATYQELLNPTAQ
Ga0306920_10009702773300032261SoilQTDALAKLPIEKGLFTREEFMQKISEERATYQKLFSPTPQ
Ga0364930_0334920_2_1093300033814SedimentAKLLIDKGIITQQEFLAKIAVERATYQKLLNPTPH
Ga0364929_0222824_256_3663300034149SedimentLAKLLIEKGIITKDEFMTKLSEERATYQRMLNPTHQ
Ga0364943_0173681_665_7843300034354SedimentTDALAKLLIEKGLITREEFMRKLSEERATYQRLFNPTPQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.