NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F106050

Metagenome / Metatranscriptome Family F106050

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106050
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 49 residues
Representative Sequence RDALRQRLAPYVREVGNELGLTAPKEQGSRSQVAGGGRRVEVMP
Number of Associated Samples 94
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.000 % of family members)
Environment Ontology (ENVO) Unclassified
(21.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 23.61%    β-sheet: 0.00%    Coil/Unstructured: 76.39%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13490zf-HC2 94.00
PF00072Response_reg 1.00
PF13305TetR_C_33 1.00
PF13620CarboxypepD_reg 1.00
PF01850PIN 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.00 %
UnclassifiedrootN/A6.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10242941All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300004138|Ga0058905_1487022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter591Open in IMG/M
3300004967|Ga0072330_1163583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter554Open in IMG/M
3300005529|Ga0070741_10068885All Organisms → cellular organisms → Bacteria → Acidobacteria4012Open in IMG/M
3300005534|Ga0070735_10217233All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300005542|Ga0070732_10387496All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300005542|Ga0070732_10856674All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005575|Ga0066702_10101797All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1643Open in IMG/M
3300005712|Ga0070764_11098614All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005921|Ga0070766_10269251All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300006028|Ga0070717_10026573All Organisms → cellular organisms → Bacteria4618Open in IMG/M
3300006052|Ga0075029_101051763All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006086|Ga0075019_10115535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1551Open in IMG/M
3300009038|Ga0099829_11033469All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300009174|Ga0105241_10508858All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300009518|Ga0116128_1070812All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300009521|Ga0116222_1544308All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300009551|Ga0105238_10881061All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300009621|Ga0116116_1018723All Organisms → cellular organisms → Bacteria2572Open in IMG/M
3300009635|Ga0116117_1034688All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300009698|Ga0116216_10731866All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300009760|Ga0116131_1093238All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300010048|Ga0126373_12376000All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300010341|Ga0074045_10635086All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300010343|Ga0074044_10107140All Organisms → cellular organisms → Bacteria1879Open in IMG/M
3300010859|Ga0126352_1182848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300010937|Ga0137776_1641777All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300011077|Ga0138572_1011024All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300011120|Ga0150983_10267083All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300011270|Ga0137391_10604081All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300012359|Ga0137385_10754890All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300014169|Ga0181531_10192884All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300014201|Ga0181537_10087546All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2114Open in IMG/M
3300014654|Ga0181525_10196005All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300014969|Ga0157376_13072501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300017924|Ga0187820_1091091All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300017936|Ga0187821_10119486All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300017943|Ga0187819_10323786All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300017973|Ga0187780_10762126All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300018006|Ga0187804_10073813All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300018009|Ga0187884_10151760All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300018038|Ga0187855_10627870All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300018088|Ga0187771_10691312All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300019264|Ga0187796_1113268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis912Open in IMG/M
3300019275|Ga0187798_1230516All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300019275|Ga0187798_1538553All Organisms → cellular organisms → Bacteria → Acidobacteria3034Open in IMG/M
3300019278|Ga0187800_1528845Not Available609Open in IMG/M
3300019284|Ga0187797_1167099All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300019786|Ga0182025_1024072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1941Open in IMG/M
3300020579|Ga0210407_10557745All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300020580|Ga0210403_10545110All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300020581|Ga0210399_10000689All Organisms → cellular organisms → Bacteria → Acidobacteria26618Open in IMG/M
3300020582|Ga0210395_10562615All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300021168|Ga0210406_10143252All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300021181|Ga0210388_10399928All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300021432|Ga0210384_10424892All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300021432|Ga0210384_10990736All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300021858|Ga0213852_1409748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae523Open in IMG/M
3300021858|Ga0213852_1569261All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300021861|Ga0213853_11606875All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300022716|Ga0242673_1016039All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300022717|Ga0242661_1023652All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300022724|Ga0242665_10025035All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300022726|Ga0242654_10113264All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300027857|Ga0209166_10528954All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300027889|Ga0209380_10362060All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300027898|Ga0209067_10186629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1111Open in IMG/M
3300027905|Ga0209415_10315046All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300027915|Ga0209069_10474550All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300028560|Ga0302144_10282908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300028765|Ga0302198_10093976All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300028766|Ga0302269_1226693All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300028773|Ga0302234_10160744All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300028775|Ga0302231_10129108All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300028863|Ga0302218_10159374Not Available716Open in IMG/M
3300029914|Ga0311359_10672791All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300029943|Ga0311340_11260812All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300029944|Ga0311352_10115362All Organisms → cellular organisms → Bacteria2351Open in IMG/M
3300029944|Ga0311352_11351635All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300030042|Ga0302300_1111711All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300030053|Ga0302177_10585065All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300030054|Ga0302182_10070860All Organisms → cellular organisms → Bacteria1556Open in IMG/M
3300030509|Ga0302183_10337418All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300030524|Ga0311357_11566308Not Available555Open in IMG/M
3300030598|Ga0210287_1245442All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300030687|Ga0302309_10388247Not Available679Open in IMG/M
3300030737|Ga0302310_10590930All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300030740|Ga0265460_12964198Not Available510Open in IMG/M
3300030740|Ga0265460_13105769Not Available500Open in IMG/M
3300030741|Ga0265459_12965965All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300030813|Ga0265750_1050948All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300030853|Ga0075372_11098445All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300030879|Ga0265765_1041785All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300031028|Ga0302180_10379379All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300031057|Ga0170834_105513060All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300031469|Ga0170819_10515390All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031715|Ga0307476_11439279All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031823|Ga0307478_11431963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis573Open in IMG/M
3300032076|Ga0306924_11754079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300032898|Ga0335072_10559446All Organisms → cellular organisms → Bacteria1164Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa14.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.00%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland5.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.00%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.00%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds3.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.00%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.00%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004138Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF246 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004967Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011077Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019264Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030853Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1024294113300001593Forest SoilGGELGLTAPEEETSLRSRNLQNQVAGGGRRVEVMP*
Ga0058905_148702213300004138Forest SoilRGRDALRQRLAPYVREVGNELGLTAPTEDNKESRGSRSQVSGGGRRVEVIS*
Ga0072330_116358323300004967Peatlands SoilVKSRLTRGRDALRQRLTPYVREVGNELGLTAPTDENKKEERDLRSRVAGGGRRVEVMP*
Ga0070741_1006888553300005529Surface SoilLRQRLAPYVREVGEELGLTAPQDGRPQLSAGGRRVEVTP*
Ga0070735_1021723323300005534Surface SoilRLRPYVREVGGELGLRELSEKVGLQSQVAAGGRRVEVMP*
Ga0070732_1038749623300005542Surface SoilRDALRQRLAPYVREVGNEMGLTAPLSDGSDGKEQRNPRSQVAGGGRRVEVMP*
Ga0070732_1085667423300005542Surface SoilVREVGNELGLSAPKEDRKERSQVAGGGRRAEVMP*
Ga0066702_1010179733300005575SoilRLTRGREALRQRLTPYVREVGSELGLTAPEQEERTQVAGGGRRVEVMP*
Ga0070764_1109861423300005712SoilALKKRLAPYVREVGEELGLTLPEEEETPSVRRQVAGGGRRVEVMP*
Ga0070766_1026925133300005921SoilQRLAPYVREVSGELGLTAPEKDDETSLRSQNLRDQVAGGGRRVEVTP*
Ga0070717_1002657313300006028Corn, Switchgrass And Miscanthus RhizosphereALRQRLAPYVRKVGNEMGLTAPLSAGSDSKEQRNLRSQVAGGGRRVEVMP*
Ga0075029_10105176323300006052WatershedsLGTVKSRITRGRQALKQRLAPYVREVGGELGLQELPEDLGLKCGLLKNRVAGGGRRVEVMP*
Ga0075019_1011553513300006086WatershedsVKSRLTRGREALRQRLTPYVREVGNELGLSAPEEEERQVAGGGRRVEVMP*
Ga0099829_1103346913300009038Vadose Zone SoilTVKSRLTRGRQALKQRLAPFVREVGGELGLSAPEEEEETSLRSQVAGGGRRVEVMP*
Ga0105241_1050885813300009174Corn RhizosphereTVKSRLTRGRQALRQRLAAYVREVGNELGLSDPGSEQERSQVAGGGRRAEVMP*
Ga0116128_107081223300009518PeatlandEVGDELGLTLPEEREEDAADSRRRVAGGGRRVEVTP*
Ga0116222_154430823300009521Peatlands SoilRQALKQRLAPYVREVGGELGLTAPEEEEEETSLRSQRLQNQVAGGGRRVEVMP*
Ga0105238_1088106113300009551Corn RhizosphereRLAAYVREVGNELGLSDPGSEQERSQVAGGGRRAEVMP*
Ga0116116_101872353300009621PeatlandLAPYVHEVGDELGLTLPEKQEEDAADLRRRVAGGGRRVEVTP*
Ga0116117_103468833300009635PeatlandKKRLAPYVREVGDELGLTLPEEREEDAADSRRRVAGGGRRVEVTP*
Ga0116216_1073186613300009698Peatlands SoilYVREVGEELGLTALESEEEERESMPSRVAGGGRKAEVMP*
Ga0116131_109323813300009760PeatlandKRLAPYVHEVGDELGLTLPEKQEEDAADLRRRVAGGGRRVEVTP*
Ga0126373_1237600013300010048Tropical Forest SoilVREVGKELGLTAPEESAEARSQVAGGGRRVEVMP*
Ga0074045_1063508623300010341Bog Forest SoilSRLTRGRQALKKRLAPYVREVGEELGLVLPEEQEKENEAADSRRPVAGGGRRVEVTP*
Ga0074044_1010714033300010343Bog Forest SoilGTVKSRITRGRQALKQRLAPYVREVGGELGLAAPDEDEEETSLRSQVAGGGRRVEVMP*
Ga0126352_118284813300010859Boreal Forest SoilRGRQALKQRLALYVREVSLELGLTVPDDAGRASLRAEVSGGGRRVEVMP*
Ga0137776_164177713300010937SedimentPYVREVGNELGLIAPAEEKRRSQVAGGGRRAEVIS*
Ga0138572_101102423300011077Peatlands SoilSRLTRGRDALRQRLAPYVREVGNELGLTAPSQEKRSQVAGGGRRVEVIS*
Ga0150983_1026708323300011120Forest SoilSYVREVGNELGLTAPSKDKRSQVAGGGRRVEVIS*
Ga0137391_1060408123300011270Vadose Zone SoilSRLTRGRQALKQRLAPFVREVGGELGLSAPEDEEETGLRSQVAGGGRRVEVMP*
Ga0137385_1075489013300012359Vadose Zone SoilQISLGTGKSRLTRGRDALRQRLAPYVREVGNELGLTAPTQDSKGERTSRNQISQNQISRTQVAGGGRRVEVIS*
Ga0181531_1019288413300014169BogTVKSRLTRGRQALKQRLAPYVREVGEELGLGDWGLGEDKGEKSLGRQVSAGVRRVEVTP*
Ga0181537_1008754633300014201BogRGRQALKQRLAPYVREVGGELGLTAPDEDKEETSLRSQNLQGQVAGGGRRVEVTP*
Ga0181525_1019600513300014654BogRLAPYVREVGEEWGLTVPEEKEEQGLRSQVSGGGRRVEVTP*
Ga0157376_1307250113300014969Miscanthus RhizosphereTVKSRLTRGRDALRQRLAAYVREVGHELGLTAPSQDSKERGARSHGAEGGRRVEVTS*
Ga0187820_109109123300017924Freshwater SedimentVREVGNELGLTAAESKDKGDRSQVAGGGRRAEVMP
Ga0187821_1011948623300017936Freshwater SedimentTRGRDALRQRLAPYVREVGNEMGLTAPMSDNKEHRNLRSQVAGGGRRVEVMP
Ga0187819_1032378623300017943Freshwater SedimentAPYVREVGNELGLTAPEEPARPQVAGGGRRVEVMP
Ga0187780_1076212613300017973Tropical PeatlandTRGRDALRQRLTPYVREVGNELGLTALEPEEGERSQVVGGGRRVEVMP
Ga0187804_1007381313300018006Freshwater SedimentRDALRQRLAPYVREVGNELGLTAPKEQGSRSQVAGGGRRVEVMP
Ga0187884_1015176033300018009PeatlandKSRITRGRQMLKKRLAPYVREVGEEMGLTLPEKENAADSRRQVAGGGRRVEVTP
Ga0187855_1062787013300018038PeatlandKQRLAPYVREVGAELGLTAPDEDEEIEQRSGVSGGGRRVEVMP
Ga0187771_1069131223300018088Tropical PeatlandREVGNELGLTAVEPQVEPGQSLRSQVAVGGRRVEVMP
Ga0187796_111326813300019264PeatlandTVKSRLTRGREALRQRLTSYVREVGQELGLSDPDSEKPARSLRSQVAGGGRRVEVMP
Ga0187798_123051623300019275PeatlandGRDALRQQLTPYVREVGSELGLTAPEPEIGSRSQVTVGVEGLR
Ga0187798_153855343300019275PeatlandQALKQRLAPYVREVAEELGLIAPEEEEASLRSQVAEGGRRVEVMP
Ga0187800_152884523300019278PeatlandGTVKSRLTRGREALRQRLASYVREVGNELGLTAPEDTNKNERNEPKVAVGGRSVEVMP
Ga0187797_116709923300019284PeatlandKSRLTRGRQALKERLMPYVRKVGAELGLTAPEEPDSETVAVGDGRVEVAP
Ga0182025_102407233300019786PermafrostTVRSRLTRGRHALKQRLAPYVREVGGELGLAPLAEDDDQAAGSRRQVSGGGRRVEVTP
Ga0210407_1055774513300020579SoilTVKSRLTRGRQALKQRLAPYVREVGGELGLSAPEEETSLRSQVAGGGRRVEVMP
Ga0210403_1054511013300020580SoilKSRLTRGRDALRQRLASYVREVGNELGLTAPTEDNKESRSSGIQIPRNQVPKDPVSGGGRRVEVIS
Ga0210399_10000689233300020581SoilDALRQRLASYVREVGNELGLTAPSKDKRSQVAGGGRRVEVIS
Ga0210395_1056261513300020582SoilRITRGRQALKQRLAPYVREVSEELGLTAPEKEETCLRSQNLQDQVAGGGRRVEVTP
Ga0210406_1014325213300021168SoilVSRGTVKSRLTRGRDALRQKLAPYVREVGNELGLTAPKEQGSRSQVAGGGRRVEVMP
Ga0210388_1039992813300021181SoilRLTRGRQALKERLAPYVREVGGEWGLTAPEEDAANLPRQVAGGGEIEVTP
Ga0210384_1042489233300021432SoilRLTRGRQALKQRLAPYVREVSLELGLTAPDDAGRASLRAEVSGGGRRVEVMP
Ga0210384_1099073613300021432SoilLKQRLAPYVREVGAELGLTRPEDEEIGLRAQVAGGGRRVEVMP
Ga0213852_140974823300021858WatershedsTVKSRLTRGREALRQRLTPYVREVGNELGLTAPEDTQTVRPQVSGGGRRAEVMP
Ga0213852_156926113300021858WatershedsEALRERLTPYVREVGDELGLAAPESKSGVRSQVAGGGRRVEVMP
Ga0213853_1160687513300021861WatershedsLRQRLTPYVREVGNELGLTAPEDKQTVRPQVSGGGRRAEVMP
Ga0242673_101603923300022716SoilLTRGRDALRQRLAPYVREVGNELGLTAPTEDNKESRSSDIQIPRNQVPKDPVSGGGRRVEVIS
Ga0242661_102365233300022717SoilLAPYVREVGNELGLTAPLADCKEQRTSRSQVAGGGRRVEVMP
Ga0242665_1002503513300022724SoilRGRDALRQRLTPYVREVGNELGLSAPMEKEARRSQVSGGGRRAEVIS
Ga0242654_1011326413300022726SoilQALKKRLAPYVREVGGELGLTLPEEEDNKTPGVRRQVAGGGRRVEVMP
Ga0209166_1052895413300027857Surface SoilRGRDALRQRLAPYVREVGNEMGLTAPLSDGSDGKEQRNPRSQVAGGGRRVEVMP
Ga0209380_1036206013300027889SoilKQRLAPYVREVSGELGLTAPEKDDETSLRSQNLRDQVAGGGRRVEVTP
Ga0209067_1018662913300027898WatershedsVKSRLTRGREALRQRLTPYVREVGNELGLSAPEEEERQVAGGGRRVEVMP
Ga0209415_1031504633300027905Peatlands SoilREILRQRLAAYVREVGDELGLAEPEPTDKQHDGLRPQVAGGGRRAEVMP
Ga0209069_1047455033300027915WatershedsLAPYVREVGSELGLTAPSQKTKDERTVRSQVAGGGRRVEVMP
Ga0302144_1028290813300028560BogVKSRLTRGRQALKQRLAPYVREVGEELGLTVPDENEENSRSRVAAGGRRVEAMP
Ga0302198_1009397623300028765BogTVKSRLTRGRQALKERLAPYVREVGQEWGLTAPQEAAELAGEEEGPSLRSQVAGGGRRLEVTP
Ga0302269_122669313300028766BogRLAPYVREVGQEWGLTAPQEAAELAGEEEGPSLRSQVAGGGRRLEVTP
Ga0302234_1016074413300028773PalsaRGRHALKQRLAPYVREVSVELGLTAPEEEEARSPVTAGGRRVEVMP
Ga0302231_1012910813300028775PalsaQRLSPYVREVGNELGLTAPTQDNKHDNKRQRDDRSLRQVAGGGRRVEVSS
Ga0302218_1015937413300028863PalsaTRGRQALKQRLAPYVREVGEELGLGDWGLGEDKGEKSLGRQVSAGVRRVEVTP
Ga0311359_1067279123300029914BogPYVREVGEELGLTVPDENEENSRSRVAAGGRRVEAMP
Ga0311340_1126081213300029943PalsaPYVREVSLELGLTAPEEEESASLRSEVAGGGRRVEVLP
Ga0311352_1011536253300029944PalsaVKSRLTRGREALRQRLAPYVREVGNELGLTAPEETSKKERNELKVAVRGRSVEVMP
Ga0311352_1135163523300029944PalsaRLAPYVREVSLELGLTAPEEEESASLRSEVAGGGRRVEVLP
Ga0302300_111171123300030042PalsaALKQRLAPYVREVSVELGLTAPEEEEARSPVTAGGRRVEVMP
Ga0302177_1058506513300030053PalsaVQEVGGELGLTIPEDDKVVALPRQVAGGGRRVEVMP
Ga0302182_1007086013300030054PalsaVKSRLTRGRHALKQRLAPYVREVSVELGLTAPEEEEARSPVTAGGRRVEVMP
Ga0302183_1033741813300030509PalsaVKSRLTRGRDALRQRLSPYVREVGNELGLTAPTQDNKHDNKRQRDDRSLRQVAGGGRRVEVSS
Ga0311357_1156630813300030524PalsaTVKSRLTRGRQALKQRLAPYVREVGEELGLGDWGLGEDKGEKSLGRQVSAGVRRVEVTP
Ga0210287_124544223300030598SoilGRQALKQRLAPYVREVGGELGLTAPEDENAAGTRRQVAGGGRRVEVMP
Ga0302309_1038824723300030687PalsaRLTRGRQALKQRLAPYVREVGEELGLGDWGLGEDKGEKSLGRQVSAGVRRVEVTP
Ga0302310_1059093013300030737PalsaRLTRGRDALRQRLSPYVREVGNELGLTAPTQDNKHDNKRQRDDRSLRQVAGGGRRVEVSS
Ga0265460_1296419813300030740SoilTVKSRLTRGRHALKQRLAPYVREVGEELGLTAPEPEEETSLGSQVAGGGRRVEVMP
Ga0265460_1310576913300030740SoilRTVKSRLTRGRQALKQRLMPYVRESGGELGLVLPDDEASGSSPRQASGIGRKAEVMP
Ga0265459_1296596523300030741SoilVKSRLTRGRQALKLRLAPYVREVGGELGLATPEEDKEASLRRRVAGGGRRVEVTP
Ga0265750_105094823300030813SoilGTVKSRITRGRQALKQRLAPYVREVGGELGLTAPEEEETILRSQNLRNQNLRNQNLRNQVAGGGRRVEVMP
Ga0075372_1109844523300030853SoilRLAPYVREVGNELGLSAPAQDKGSRREVARAQVAGGGRRVEVMP
Ga0265765_104178513300030879SoilKRLAPYVREVGEEMGLTVPEEEDAGNGRRQVAGGGRRVEVMP
Ga0302180_1037937923300031028PalsaRLAPYVREVSLELGLTAPEEEETASLMSEVARGGRRVEVLP
Ga0170834_10551306023300031057Forest SoilRQRLAPYVREIGNELGLTAPSQDKEGRRSQVAGGGRRVEVMP
Ga0170819_1051539023300031469Forest SoilGTVKSRLTRGRDALRQRLAPYVREVGNELGLTAPTQDGKGERNLRNEISRNEISRTHVAGGGRRVEVMP
Ga0307476_1143927913300031715Hardwood Forest SoilVREVGDELGLTAPLSDSKEQRTSRSQVAGGGRRVEVIP
Ga0307478_1143196323300031823Hardwood Forest SoilTVKSRLTRGREALRQRLTPYVREVGNELGLTAPEERARPQVAGGGRRVEVTP
Ga0306924_1175407913300032076SoilYIREVGNELGLTAIESGTDRGERRQVSGGGRRAEVLP
Ga0335072_1055944623300032898SoilREALRQRLTPYVREVGNELGLAETRLEKNDERSLRPQVAGGGRRVEVMP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.