NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F106025

Metagenome / Metatranscriptome Family F106025

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106025
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 40 residues
Representative Sequence FLRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM
Number of Associated Samples 90
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.00 %
% of genes near scaffold ends (potentially truncated) 98.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.000 % of family members)
Environment Ontology (ENVO) Unclassified
(22.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.97%    β-sheet: 0.00%    Coil/Unstructured: 53.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF03473MOSC 41.00
PF01715IPPT 30.00
PF13520AA_permease_2 10.00
PF06441EHN 2.00
PF00072Response_reg 1.00
PF01184Gpr1_Fun34_YaaH 1.00
PF16640Big_3_5 1.00
PF02416TatA_B_E 1.00
PF07690MFS_1 1.00
PF06745ATPase 1.00
PF04203Sortase 1.00
PF00561Abhydrolase_1 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0324tRNA A37 N6-isopentenylltransferase MiaATranslation, ribosomal structure and biogenesis [J] 30.00
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 2.00
COG1584Succinate-acetate transporter SatPEnergy production and conversion [C] 1.00
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 1.00
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.00 %
UnclassifiedrootN/A26.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005843|Ga0068860_101514055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia692Open in IMG/M
3300006028|Ga0070717_10457666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1150Open in IMG/M
3300006028|Ga0070717_10764421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia878Open in IMG/M
3300006162|Ga0075030_101315299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300006163|Ga0070715_10016367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2785Open in IMG/M
3300006173|Ga0070716_100438988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia948Open in IMG/M
3300006175|Ga0070712_100013417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae5237Open in IMG/M
3300006755|Ga0079222_10472144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia906Open in IMG/M
3300006806|Ga0079220_10454117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia858Open in IMG/M
3300006953|Ga0074063_14020543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300009148|Ga0105243_10115817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2251Open in IMG/M
3300009162|Ga0075423_11338057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria766Open in IMG/M
3300009545|Ga0105237_12621693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300010043|Ga0126380_12125491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300010371|Ga0134125_10463573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1405Open in IMG/M
3300010379|Ga0136449_101456373Not Available1052Open in IMG/M
3300010379|Ga0136449_104242756Not Available531Open in IMG/M
3300010399|Ga0134127_12831605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300010403|Ga0134123_10076851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2588Open in IMG/M
3300010866|Ga0126344_1377385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300010880|Ga0126350_11705843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1351Open in IMG/M
3300012200|Ga0137382_10296784Not Available1127Open in IMG/M
3300012285|Ga0137370_10446631Not Available787Open in IMG/M
3300012351|Ga0137386_10320181Not Available1116Open in IMG/M
3300012356|Ga0137371_10015427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae5872Open in IMG/M
3300012359|Ga0137385_10247140Not Available1546Open in IMG/M
3300012927|Ga0137416_11919273Not Available542Open in IMG/M
3300012958|Ga0164299_10090368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1564Open in IMG/M
3300013100|Ga0157373_10942136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300013102|Ga0157371_10917583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia665Open in IMG/M
3300013307|Ga0157372_10694958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1184Open in IMG/M
3300014325|Ga0163163_10347539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1539Open in IMG/M
3300016294|Ga0182041_12337581Not Available500Open in IMG/M
3300016319|Ga0182033_10748112All Organisms → cellular organisms → Bacteria → Terrabacteria group858Open in IMG/M
3300017821|Ga0187812_1053642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1354Open in IMG/M
3300017822|Ga0187802_10110521Not Available1037Open in IMG/M
3300017926|Ga0187807_1278192Not Available553Open in IMG/M
3300017948|Ga0187847_10214731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1048Open in IMG/M
3300017995|Ga0187816_10051209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1726Open in IMG/M
3300018042|Ga0187871_10745970Not Available545Open in IMG/M
3300018468|Ga0066662_12921406Not Available507Open in IMG/M
3300019356|Ga0173481_10501054All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300020581|Ga0210399_10696294All Organisms → cellular organisms → Bacteria → Terrabacteria group836Open in IMG/M
3300021171|Ga0210405_10049159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3339Open in IMG/M
3300021181|Ga0210388_11156485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300021181|Ga0210388_11216984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300021374|Ga0213881_10150070Not Available1021Open in IMG/M
3300021374|Ga0213881_10185334Not Available917Open in IMG/M
3300021401|Ga0210393_10393590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1129Open in IMG/M
3300021401|Ga0210393_10592166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia906Open in IMG/M
3300022521|Ga0224541_1015254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mimosae827Open in IMG/M
3300022720|Ga0242672_1111973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300025928|Ga0207700_11908975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300025929|Ga0207664_11962085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300027030|Ga0208240_1043439Not Available508Open in IMG/M
3300027857|Ga0209166_10322185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia811Open in IMG/M
3300027869|Ga0209579_10781745Not Available516Open in IMG/M
3300028747|Ga0302219_10146355Not Available904Open in IMG/M
3300028759|Ga0302224_10222693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300028775|Ga0302231_10240768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia756Open in IMG/M
3300028789|Ga0302232_10421440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia656Open in IMG/M
3300028789|Ga0302232_10516159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300028876|Ga0307286_10282598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300028877|Ga0302235_10296794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300030007|Ga0311338_10889284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300030013|Ga0302178_10061581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2023Open in IMG/M
3300030043|Ga0302306_10278717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300030520|Ga0311372_10545386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes1681Open in IMG/M
3300030520|Ga0311372_10999602Not Available1105Open in IMG/M
3300030743|Ga0265461_11559174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia720Open in IMG/M
3300031198|Ga0307500_10239249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300031233|Ga0302307_10135861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1279Open in IMG/M
3300031546|Ga0318538_10692388Not Available553Open in IMG/M
3300031679|Ga0318561_10202462All Organisms → cellular organisms → Bacteria → Terrabacteria group1077Open in IMG/M
3300031716|Ga0310813_11284223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300031719|Ga0306917_10474923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces981Open in IMG/M
3300031781|Ga0318547_10112996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1566Open in IMG/M
3300031781|Ga0318547_10417956All Organisms → cellular organisms → Bacteria → Terrabacteria group824Open in IMG/M
3300031793|Ga0318548_10567294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300031797|Ga0318550_10461527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300031805|Ga0318497_10560802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300031821|Ga0318567_10431593All Organisms → cellular organisms → Bacteria → Terrabacteria group747Open in IMG/M
3300031833|Ga0310917_10846016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300031860|Ga0318495_10217995All Organisms → cellular organisms → Bacteria → Terrabacteria group857Open in IMG/M
3300031941|Ga0310912_10682951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300032009|Ga0318563_10371253All Organisms → cellular organisms → Bacteria → Terrabacteria group774Open in IMG/M
3300032010|Ga0318569_10376022Not Available662Open in IMG/M
3300032010|Ga0318569_10378284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300032054|Ga0318570_10558212Not Available522Open in IMG/M
3300032068|Ga0318553_10160277All Organisms → cellular organisms → Bacteria → Terrabacteria group1166Open in IMG/M
3300032076|Ga0306924_11012788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces911Open in IMG/M
3300032089|Ga0318525_10090227All Organisms → cellular organisms → Bacteria → Terrabacteria group1555Open in IMG/M
3300032090|Ga0318518_10634092Not Available544Open in IMG/M
3300032160|Ga0311301_10576022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1634Open in IMG/M
3300032174|Ga0307470_11539232Not Available554Open in IMG/M
3300032205|Ga0307472_102745576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300032892|Ga0335081_10035455All Organisms → cellular organisms → Bacteria7976Open in IMG/M
3300032892|Ga0335081_11621866Not Available709Open in IMG/M
3300032895|Ga0335074_11166130Not Available654Open in IMG/M
3300032896|Ga0335075_11621276Not Available531Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa12.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock2.00%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.00%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027030Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068860_10151405523300005843Switchgrass RhizosphereGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM*
Ga0070717_1045766633300006028Corn, Switchgrass And Miscanthus RhizosphereGLGEDLFTERVAARVARMLCADNAKRAYQLGCEM*
Ga0070717_1076442113300006028Corn, Switchgrass And Miscanthus RhizosphereAGLGEDLFTERVAARVARMLCADNAKRAYQLGCEM*
Ga0075030_10131529913300006162WatershedsGLDEDLYSERTVVRMSRMFCADNAKRAYQLGRQMLLVS*
Ga0070715_1001636713300006163Corn, Switchgrass And Miscanthus RhizosphereSAFLRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM*
Ga0070716_10043898813300006173Corn, Switchgrass And Miscanthus RhizosphereFLRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM*
Ga0070712_10001341713300006175Corn, Switchgrass And Miscanthus RhizosphereSAFLRSGLEEDLFTERAVVRVARMLSADNAKRAYRLGDQM*
Ga0079222_1047214433300006755Agricultural SoilSAFLRTGLEEDLYTERTAARLARMLCADNAKRAYRLGDQISW*
Ga0079220_1045411723300006806Agricultural SoilSGFLRAGLEEDLCTERVAARVARMLCADNAKRAYRLGSEM*
Ga0074063_1402054313300006953SoilGLEEDLYTERTAARLAQMLCADNARRAYRLGDQM*
Ga0105243_1011581743300009148Miscanthus RhizosphereLRSGLEEDLYTERTAARLARMLCANNAKRAYRLGNQM*
Ga0075423_1133805733300009162Populus RhizosphereRSGLEDDLYTEGTAARLARMLCADNAKRAYRLGDQM*
Ga0105237_1262169313300009545Corn RhizosphereSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM*
Ga0126380_1212549123300010043Tropical Forest SoilSGLEEDLFTEPTAARLARMICAGNARRAYRLGDQM*
Ga0134125_1046357313300010371Terrestrial SoilRSALSAFLRSGLEEDIYTERTAARLARMLGADNAKRAYRLGDQM*
Ga0136449_10145637313300010379Peatlands SoilLSAFFASGLDEDLYTERTVLRLTKMICADNAKRAYALGDQM*
Ga0136449_10424275623300010379Peatlands SoilAFFTAGLNEDLYTERTVLRLTKMICADNAKRAYALGDQM*
Ga0134127_1283160523300010399Terrestrial SoilSAFLRSGLEEDLYTEPTAARLARMLCADNAKRAYRLGDHM*
Ga0134123_1007685113300010403Terrestrial SoilSAFLRSGLDEDLYTERTAARLARMLCADNAKRAYRLGDQM*
Ga0126344_137738513300010866Boreal Forest SoilFHTAGPEEDHFSGRTVVRLTRMLCADNAKRAYQLAN*
Ga0126350_1170584353300010880Boreal Forest SoilAGVQEDHFSERTVVRLTRMLCADNAKRVYQLASQM*
Ga0137382_1029678423300012200Vadose Zone SoilAFLRSGLEEDLFTERTAARLARMLCADNAKRAYRLGDQM*
Ga0137370_1044663113300012285Vadose Zone SoilLRSGLEEDLFTERTAARLARMLCADNAKRAYQLGDQM*
Ga0137386_1032018113300012351Vadose Zone SoilSGLEEDLFTERTAARLARMLCADNATRAYRLGNQM*
Ga0137371_1001542773300012356Vadose Zone SoilLSAFLRSGLEEDLFTERTAARLARMLGADNAKRAYQLGDQM*
Ga0137385_1024714043300012359Vadose Zone SoilGLDDDLYTERAAIRLTKMICADNAKRAYQLGGQM*
Ga0137416_1191927313300012927Vadose Zone SoilRSALSAFLRSGLEEDIYTERTAARLARMLGADNAKRAYQLGDQM*
Ga0164299_1009036833300012958SoilRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDHM*
Ga0157373_1094213633300013100Corn RhizosphereRSALSAFLRSGLEEDLYTEPTAARLARMLCADNAKRAYRLGDHM*
Ga0157371_1091758313300013102Corn RhizosphereSCLRSGLEEDLYTERTAARLARRLCADNAKRAYRLGDQM*
Ga0157372_1069495813300013307Corn RhizosphereRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM*
Ga0163163_1034753933300014325Switchgrass RhizosphereFLRSGLEEDLYTEPTAARLARMLCADNAKRAYRLGDHM*
Ga0182041_1233758123300016294SoilAAGLAEDLYSERTVVRLTRMLCADNAKRAYGLGDQM
Ga0182033_1074811213300016319SoilLSEFLSAGLDEGLYTERTVVRLTRMLGADNAKRAYGLGDQM
Ga0187812_105364213300017821Freshwater SedimentLSDFLSAGLQEDLYTERTVVRLTRMLCADNAKRAYRLGDQM
Ga0187802_1011052123300017822Freshwater SedimentTALSGFLAAGLQEDLFTERTVVRLTRMLCADNAKRAYGLGDQM
Ga0187807_127819223300017926Freshwater SedimentVLGGFLAAGLQEDLYTERTVARLTRMLCAENARRACRLGDQM
Ga0187847_1021473133300017948PeatlandLSDFLRAGIEEDLYSERTVARLTRMLCADNAKRAYQLADQM
Ga0187816_1005120913300017995Freshwater SedimentALSALFAAGLDEDLYTERTMLRLTKMICADNAKRAYALGDQM
Ga0187871_1074597023300018042PeatlandAGLSGDLYSERTVVRLARMLCADNAKRAYGLGDRM
Ga0066662_1292140613300018468Grasslands SoilEFLRTSLEEDLFTERAAARVARMLSSDNAKHAYQLGREM
Ga0173481_1050105423300019356SoilSALSAYLRTGLDQDIFTERTVVRVARMLSADNAKRAYQLGDQM
Ga0210399_1069629413300020581SoilAGLDEGLYTERTVVRLTRMLGADNAKRAYGLGDQM
Ga0210405_1004915913300021171SoilLFRTALSAFLEAGVQEDHFSERTVVRLTRMLCADNAKRAYQLGDQM
Ga0210388_1115648513300021181SoilLRTGLDEGFYPERAVARLTRMICADNAKRAYRLGDKM
Ga0210388_1121698423300021181SoilRTALSGFLTAGLQEDHFSERTVVRLTRMLCADNAKRAYQLGDQM
Ga0213881_1015007023300021374Exposed RockSALSEFRRAGLEQDLYTERAAIRLTRMLGADNAKRAYQLGSQM
Ga0213881_1018533423300021374Exposed RockAALFRSALSEFLRAGLEQDLYTERVAARLTRMLGADNAKRAYQLGSQM
Ga0210393_1039359033300021401SoilFLRNGLAEDLYTERTTVRLTRMICADNAKRAYQLGSQM
Ga0210393_1059216633300021401SoilFLPAGLQEDHFSDRTVVRLTRMLCADNAKRAYQLANQM
Ga0224541_101525413300022521SoilFRTALSGLLTAGLEEDHYSERTVVRLTRMLCADNAKRAYRLANQM
Ga0242672_111197323300022720SoilALFRSALSAFLRSGLEEELFTERTAARLARMLGADNAKRAYQLGDQM
Ga0207700_1190897513300025928Corn, Switchgrass And Miscanthus RhizosphereSALSGFLRSGLEEDLFTERVAARVARMLCADNAKRAYQLGCEM
Ga0207664_1196208523300025929Agricultural SoilFLRAGLGEDLFTERVAARVTRMLCADNAKRAYQLGCEM
Ga0208240_104343923300027030Forest SoilLSAFLTAGLQEDHFSERTVVRLTRMLCADNAKRAYQLGDQM
Ga0209166_1032218523300027857Surface SoilVLFRTALSGFLTAGVQEDHFSERTVVRLTRMLCADNAKRAYRLATQM
Ga0209579_1078174513300027869Surface SoilSAFFTAGLNEDLYPERTVVRLTKMICADNAKRAYALGDQM
Ga0302219_1014635523300028747PalsaRRALSGFLRAGLEEDLYSERTVARLTRMLCADNAKRAYQLANQM
Ga0302224_1022269313300028759PalsaGFLRSGLEEDLYSERTVVRLTRMLCADNAKRAYRLGDQM
Ga0302231_1024076813300028775PalsaFLRSGLEEDLYSERTVVRLTRMLCADNAKRAYRLGDQM
Ga0302232_1042144013300028789PalsaFLHAGLDDDLYTERTAVRLARMLCADNAKRVYQLGERM
Ga0302232_1051615913300028789PalsaLAEFLHAGLDDDLYTERTAVRLARMLCADNAKRVYRLEEQL
Ga0307286_1028259823300028876SoilLRTGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM
Ga0302235_1029679423300028877PalsaRALSDFLRAGIEEDLYSERTVVRLTRMLCADNAKRAYQLGGPFL
Ga0311338_1088928423300030007PalsaSDFLRTGLEEDLYSERTVVRLTRMLCADNAKRAYQLADQM
Ga0302178_1006158113300030013PalsaMLFRTALSGLLTAGLEDDHYSERTVVRLTRMLCADNAKRAYQLANQM
Ga0302306_1027871713300030043PalsaSGLEEDLYSERTVVRLTRMLCADNAKRAYRLGDQM
Ga0311372_1054538613300030520PalsaAGIEEDLYSERTVVRLTRMLCADNAKRAYQLGGPFL
Ga0311372_1099960233300030520PalsaSAHLSAGRAEDLYPERAVVRLTRMLCADNARRVYALGEQM
Ga0265461_1155917423300030743SoilSDFLRTGMNEGFYPERAVARLTRMICADNAKRAYRLGDKM
Ga0307500_1023924913300031198SoilRSALSAFLRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM
Ga0302307_1013586133300031233PalsaLAAALFRTALSGLLTAGLEEDHYSERTVVRLTRMLCADNAKRAYRLANQM
Ga0318538_1069238823300031546SoilALSEFLSAGLDEGLYTERTVVRLTRMLGADNAKRAYGLGDQM
Ga0318561_1020246213300031679SoilSEFLSAGLDEGLYTERTVVRLTRMLGADNAKRAYGLGDQM
Ga0310813_1128422323300031716SoilFLQTGLEQDLYTERTAARLARMLCADNAKRAYRLGDQM
Ga0306917_1047492313300031719SoilRSGLDEDLFTEPTAARLARMICAGNAKRAYRLGDRM
Ga0318547_1011299613300031781SoilFRLALSVFLRSGLEEDLFTERTAARLARMLCADNAKRAYQLGDQM
Ga0318547_1041795623300031781SoilFNAGLGEGLYTERTVVRLTRMLGADNAKRAYGLGDQM
Ga0318548_1056729423300031793SoilFLRSGLEEDLYTERTAARLARMLCADNARRAYQLGDQL
Ga0318550_1046152713300031797SoilVGLGEGLYTERTVVRLTRMLGADNAKRAYGLGDQM
Ga0318497_1056080223300031805SoilRRALSEFFNAGLGEGLYTERTVVRLTRMLCADNAKRAYGLGEQM
Ga0318567_1043159323300031821SoilEFLSAGLDEDLYSERTVVRLTRMLGADNAKRAYGLGDQM
Ga0310917_1084601613300031833SoilALSDFLAAGLAEDLYSERTVVRLTRMLCADNAKRAYGLGEQM
Ga0318495_1021799513300031860SoilLFSGLEQNLYTERTAARLARMLCADNAKRAYGLGDQM
Ga0310912_1068295113300031941SoilRSGLEEDLFTEGTAARLARMLGADNAKRAYQLGDQM
Ga0318563_1037125313300032009SoilSDFLAAGVAEDLYPERTVVRLTRMLCADNAKRAYGLGDQM
Ga0318569_1037602223300032010SoilLAAGLQDDLYSERTVVRLARMLCADNAKRAYGLADQM
Ga0318569_1037828413300032010SoilSEFFNAGLGEGLYTERTVVRLTRMLGADNAKRAYGLGDQM
Ga0318570_1055821213300032054SoilDFLAAGLAEDLYSERTVVRLTRMLCADNAKRAYGLGDQM
Ga0318553_1016027713300032068SoilEFFNAGLGEGLYTERTVVRLTRMLCADNAKRAYGLGEQM
Ga0306924_1101278813300032076SoilLFRSALSAFLRSGLEEDLFTEATAARLARMLGADNAKRAYQLGDQM
Ga0318525_1009022713300032089SoilTAGLDEDLYSERTVVRLTRMLCADNAKRAYGLGDQM
Ga0318518_1063409223300032090SoilRALSEFFNAGLGEGLYTERTVVRLTRMLCADNAKRAYGLGEQM
Ga0311301_1057602233300032160Peatlands SoilLSGFLTAGLQEDLFTERTVVRLTRMLCADNAKRAYRLGDQM
Ga0307470_1153923223300032174Hardwood Forest SoilSALFRSALSAFLRSGLEDKLFTERAVVRVARMLSAENAKRAYQLGDQM
Ga0307472_10274557623300032205Hardwood Forest SoilFLRSGLEEDLFTERTAARLARMLGAENAKRAYQLGDQM
Ga0335081_10035455113300032892SoilSAFLRSGLSEDLFTERTAVRLTRMFCADNAKRAYQLGSQM
Ga0335081_1162186613300032892SoilFLRSGLSEDLYTERTAIRLTRMFCADNAKRAYQLGSQM
Ga0335074_1116613013300032895SoilSGLFAAGLDEDLYTERTVLRLTKMICADNAKRAYALGDQM
Ga0335075_1162127623300032896SoilGLPEPYFLGAALFRTALSVLFTEGLNEDLYAERTVLRLTKMICADNAKRAYALGDQM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.