 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F106005 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | KIEIITRNSAGKAVVQEFEPAQEAGPPEKAAVEPESTDDEIKLF |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.67% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13292 | DXP_synthase_N | 96.00 |
| PF02401 | LYTB | 1.00 |
| PF02609 | Exonuc_VII_S | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 2.00 |
| COG1722 | Exonuclease VII small subunit | Replication, recombination and repair [L] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026816 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02829520 | 2088090014 | Soil | RNSAGKAVVKEFEPAPEAGPPDKAATQSTDDEINLF |
| AP72_2010_repI_A01DRAFT_10168091 | 3300000579 | Forest Soil | EQKIEIITRNSAGKAVVKEFDPPKEPAAPEKTAIESESTDDEIKLF* |
| JGI12627J18819_104432162 | 3300001867 | Forest Soil | EQKIEIITRNSAGKAVVQEFESAQEGPPEKKAVESESTDDEIKLF* |
| Ga0062592_1011353061 | 3300004480 | Soil | NAEQKIEIITRNSAGKPVVKEFEPAQEAGPPEKTAIESESTDDEIKLF* |
| Ga0062594_1030887092 | 3300005093 | Soil | QKIEIITRNSAGKAVVKEFDPPKEPAAPEKTAIESESTDDEIKLF* |
| Ga0066680_101054851 | 3300005174 | Soil | IEIIARNSAGKAVVKDFEPTQEPTSPEEPAAESERTDDEIKLF* |
| Ga0066678_101380712 | 3300005181 | Soil | AEQKIEIIARNSAGKPVVKEFEPTQEAAATDKKIEEPESTDDEIKLF* |
| Ga0066675_106036272 | 3300005187 | Soil | IARNSAGKPVVKEFEPTQEAAATDKKIEESEGTDDEIKLF* |
| Ga0065703_10241311 | 3300005272 | Switchgrass Rhizosphere | RLANAEQKIEIITRNSAGKAVVQEFEPAQEAGPPEKAAVESERIDDEINLF* |
| Ga0065704_107632291 | 3300005289 | Switchgrass Rhizosphere | IEIITRNTAGKAVVQEFEPAQEAGPPEKTAVESESTDDEIKLF* |
| Ga0066388_1039016481 | 3300005332 | Tropical Forest Soil | KIEIITRNSAGKAVVQEFEAAQEAGPPEKTAAESESPDDEIKLF* |
| Ga0066388_1084756612 | 3300005332 | Tropical Forest Soil | NAEQKIEIIARNSAGKPVLKEFEQTQESGTSEKTVTERESPDDEIKLF* |
| Ga0070682_1005152761 | 3300005337 | Corn Rhizosphere | LANAEQKIKIITRNSAGKAVVKEFEPAQEANSPEKAAVEAESTDDEIKLF* |
| Ga0070660_1002624992 | 3300005339 | Corn Rhizosphere | LANAEQKIEIITRNSAGKAVVQEFQPAQEAAPSDKAAVESESIDDEINLF* |
| Ga0070687_1010320221 | 3300005343 | Switchgrass Rhizosphere | EQKIEIITRNSAGKAVVQQFEPAQEAAPSEKPAVESESTDDEINLF* |
| Ga0070675_1021316781 | 3300005354 | Miscanthus Rhizosphere | NAEQKIEIITRNSAGKAVVKEFEPAQEASPPEQTAIESESTDDEIKLF* |
| Ga0008090_100315112 | 3300005363 | Tropical Rainforest Soil | IEIITRNSAGKAVVQEFEPAQEAGPPEKPAVESTDDEIKLF* |
| Ga0070673_1003207271 | 3300005364 | Switchgrass Rhizosphere | EQKIEIITRNSAGKAVVQQFEPVQEAAPSEKPAVEPESTDDEINLF* |
| Ga0070709_105724861 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AEQKIEIITRNSAGKAVIQEFEPTQEAGPATKTAVESESTDDEIKLF* |
| Ga0070700_1001684241 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | EQKIKIITRNSAGKAVVKEFEPAQEANSPEKAAVEAESTDDEIKLF* |
| Ga0070663_1012152792 | 3300005455 | Corn Rhizosphere | IITRNSAGKAVVKEFEPAQEANSPEKAAVEAESTDDEIKLF* |
| Ga0070679_1020059051 | 3300005530 | Corn Rhizosphere | EQKIEIITRNSAGKAVVQEFEPAQEVGPSEKAAVESESIDDEIKLF* |
| Ga0070684_1008030572 | 3300005535 | Corn Rhizosphere | TRNSAGKAVVQQFEPAQEASPSEKPAVESESTDDEINLF* |
| Ga0066697_101434701 | 3300005540 | Soil | NAEQKIEIIARDSAGKSVIKEFEPAEDRAAPGKTVAESDSTNDEIKLF* |
| Ga0066698_105977951 | 3300005558 | Soil | NSAGRAVVKELEPTQDQTAPEEPVAESENTDDEIKLF* |
| Ga0066698_109279242 | 3300005558 | Soil | EQKIEIIARNSAGKPVIKEFEPAQEPASPEKAPAEPESTNDEIKLF* |
| Ga0066903_1001213895 | 3300005764 | Tropical Forest Soil | IITRNSAGKAVVQEFEPAQEGSPPEKAAVESESTDDEIKLF* |
| Ga0066903_1009975502 | 3300005764 | Tropical Forest Soil | AEQKIEIITRNSAGKAVVKEFEPAQEAGPPEKAAVEAESTDDEIKLF* |
| Ga0066903_1074607692 | 3300005764 | Tropical Forest Soil | EIITRNSAGKAVVQEFEPAQEAGPPEKTAVESESTDDEIKLF* |
| Ga0066903_1083548872 | 3300005764 | Tropical Forest Soil | ERLANAEQKIEIITRNSAGKAVVQGFESAQEGPPEKEAVESESTDDEIKLF* |
| Ga0068863_1023344991 | 3300005841 | Switchgrass Rhizosphere | NAEQKIEIITRNSAGKAVVQQFEPAQEAAPSEKPAVESESTDDEINLF* |
| Ga0070715_102135321 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RNSAGKAVVQEFEPTQEAVPPEKATVEPESTDDEIKLF* |
| Ga0075424_1027356491 | 3300006904 | Populus Rhizosphere | EIITRNSAGKAVVQEFERTQEAGPPQKTAVESESTDDEIKLF* |
| Ga0111539_104787111 | 3300009094 | Populus Rhizosphere | EQKIEIITRNSAGKAVVKEFDPPKESAAPEKTAIQSESTDDEIKLF* |
| Ga0105247_104933001 | 3300009101 | Switchgrass Rhizosphere | QKIEIITRNTAGKAVVQEFEPAQEAGPPEKAAVESESTDDEIKLF* |
| Ga0066709_1028951631 | 3300009137 | Grasslands Soil | SAGKAVVQEFEPTQEAGPPEKAAVEPESTDDEIKLF* |
| Ga0126374_118117841 | 3300009792 | Tropical Forest Soil | KIEIITRNSAGKAVVKEFEAAQEAGTPGKAVVESESTDDEIKLF* |
| Ga0126373_103304842 | 3300010048 | Tropical Forest Soil | TRNSAGKAVVKEFEPAQEAGPSEKAAVEAESTDDEIKLF* |
| Ga0134082_101923222 | 3300010303 | Grasslands Soil | EQKIEIIARDSAGKPVIKEFEPAEDRAAPGKPVAESDSTNDEINLF* |
| Ga0134084_101888751 | 3300010322 | Grasslands Soil | AGKAVVQEFEPAQEAGPPEKAAVEPESTDDEIKLF* |
| Ga0134065_100655001 | 3300010326 | Grasslands Soil | LANAEQKIEIITRNSAGKAVVQEFEPAQEAGPPDKRAVESESTDDEIKLF* |
| Ga0126376_103166382 | 3300010359 | Tropical Forest Soil | GKAVVKEFEPAQEAGPPEKAAVESESTDDEIKLF* |
| Ga0134128_113459611 | 3300010373 | Terrestrial Soil | NAEQKIEIITRNSAGKAVVKEFEPAQEASPPEKAAVEAESTDDEIKLF* |
| Ga0134128_131824781 | 3300010373 | Terrestrial Soil | AEQKIEIITRNSAGKAVVKEFEPAQEASPPEQTAIESESTDDEIKLF* |
| Ga0126383_117388711 | 3300010398 | Tropical Forest Soil | RLANAEQKIEIITRNSAGKAVVQEFEPTQEAGPPAKTAVESESSDDEIKLF* |
| Ga0134127_106093111 | 3300010399 | Terrestrial Soil | LANAEQKIEIITRNSAGKAVVQEFEPAQEAGPPEKTTVESESTDDEIKLF* |
| Ga0137364_102282001 | 3300012198 | Vadose Zone Soil | EQKIEIITRNSAGKAVVQEFEPAQEAGPPDKRAVESESTDDEIKLF* |
| Ga0137364_107115451 | 3300012198 | Vadose Zone Soil | EQKIEIIARDSAGKSVIKEFEPAEDRAAPGKTGAESDSTNDEIKLF* |
| Ga0137399_111461452 | 3300012203 | Vadose Zone Soil | EQKIEIIARDSAGKSVIKEFEPAEDRAAPGKTVAESDSTNDEIKLF* |
| Ga0137370_104488111 | 3300012285 | Vadose Zone Soil | NAEQKIEIIARNSAGKPVVKEFDPPKEPAAPEKTAIESESTDDEIKLF* |
| Ga0137370_106388891 | 3300012285 | Vadose Zone Soil | RDSAGKPVIKEFEPAEERAAPEKTVAESDSTNDEINLF* |
| Ga0137371_106993291 | 3300012356 | Vadose Zone Soil | LANAEQKIEIITRNSAGKAVVQEFEPTQEAGPPEKAAVEPESTDDEIKLF* |
| Ga0137416_101829411 | 3300012927 | Vadose Zone Soil | KIEIITRNSAGKAVVQEFEPAQEAGPPEKAAVEPESTDDEIKLF* |
| Ga0137407_100537581 | 3300012930 | Vadose Zone Soil | RNSAGKPVVKEFEPTQEAAATDKKIEEPESTDDEIKLF* |
| Ga0137407_112555761 | 3300012930 | Vadose Zone Soil | NAEQKIEIITRNSAGKAVVQEFEPAQEAGPPDKTAVESESTDDEIKLF* |
| Ga0162650_1000950091 | 3300012939 | Soil | NSAGKAVVQEFEPAQEAGPPEKAAVESESTDDEIKLF* |
| Ga0137410_110801001 | 3300012944 | Vadose Zone Soil | DSAGKPVIKEFEPVEERAAPEKTVAESDSTNDEIKLF* |
| Ga0126375_109685651 | 3300012948 | Tropical Forest Soil | IITRNSAGKAVVKEFEPAQEAGPPEKTTVESESTDDEIKLF* |
| Ga0134076_103349802 | 3300012976 | Grasslands Soil | MIARNSAGKPVVKEFEPTQEAAATDKKIEEPESTDDEIKLF* |
| Ga0134087_107894391 | 3300012977 | Grasslands Soil | EQKIEIITRNSTGKTVVQEFESAQVADPPEKAAVESESTNDEIKLF* |
| Ga0164305_120307351 | 3300012989 | Soil | LANAEQKIEIITRNSAGKAVVQEFEPAQEAGPPEKAAVEPESSDDEIKLF* |
| Ga0157371_105629012 | 3300013102 | Corn Rhizosphere | LANAEQKIEIITRNSAGKAVVQQFEPVQEAAPSEKPAVEPESTDDEINLF* |
| Ga0157374_101638421 | 3300013296 | Miscanthus Rhizosphere | TWHDRVGNAEQKIKSITRKSAWKAVVKEFEPAQEANSPEKAAVEAESTDDEIKLF* |
| Ga0157374_102951432 | 3300013296 | Miscanthus Rhizosphere | IEIITRNSAGKAVVKEFEPAQEASPPEKTAIEAESTDDEIKLF* |
| Ga0157375_100339991 | 3300013308 | Miscanthus Rhizosphere | KIEIITRNSAGKAVVKEFEPAQEANSPEKAAVEAESTDDEIKLF* |
| Ga0173480_105074741 | 3300015200 | Soil | IEIITRNSAGKAVVQEFEPAQESGPPEKTAVESESTDDEIKLF* |
| Ga0132256_1011212472 | 3300015372 | Arabidopsis Rhizosphere | RNSAGKAVVKEFEPAQEAGPPEKAAVEAESTDDEIKLF* |
| Ga0132257_1001695511 | 3300015373 | Arabidopsis Rhizosphere | KIEIITRNSAGKAVVKEFEPAQEAGPPEKAAVEAESTDDEIKLF* |
| Ga0132257_1006504562 | 3300015373 | Arabidopsis Rhizosphere | ERLANAEQKIKIITRNSAGKAVVKEFEPAQEAGSPEKAAVEAESTDDEINLF* |
| Ga0132255_1037085011 | 3300015374 | Arabidopsis Rhizosphere | RLANAEQKIEIITRNSTGKAVVQEFEPTQEAGPSEKATVESESIDDEIKLF* |
| Ga0193712_10817292 | 3300019880 | Soil | TRNTAGKAVVQEFEPAQEAGPPEKAAVESESTDDEIKLF |
| Ga0193731_10223122 | 3300020001 | Soil | KIEMIARNSAGKPVVKEFEPTQEAAATDKKIEEPESTDDEIKLF |
| Ga0210381_100747491 | 3300021078 | Groundwater Sediment | ANAEQKIEIITRNTAGKAVVQEFEPAQEAGPPEKTAVESESTDDEIKLF |
| Ga0179596_102879261 | 3300021086 | Vadose Zone Soil | KIEIITRNSAGKAVVQEFEPAREAGPPEKTAVESESTDDEIKLF |
| Ga0193719_100779622 | 3300021344 | Soil | IEIIARNSAGKPVVKEFEPTQEAAATDKKIEEPESTDDEIKLF |
| Ga0222623_104097352 | 3300022694 | Groundwater Sediment | IITRNSAGKAVVQEFEPAQEAGPPEKAAVESESTDDEIKLF |
| Ga0247692_10055331 | 3300024279 | Soil | IITRNSAGKAVVKEFEPVQEAGPPEKAAVEAESTDDEIKLF |
| Ga0207697_105614672 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | SAGKAVVQEFEPAQEAGPPEKAAVEPESDDDEIKLF |
| Ga0207657_102501282 | 3300025919 | Corn Rhizosphere | ERLANAEQKIEIITRNSAGKAVVQEFQPAQEAAPSDKAAVESESIDDEINLF |
| Ga0207678_108861672 | 3300026067 | Corn Rhizosphere | IITRNSAGKAVVKEFEPAQEANSPEKAAVEAESTDDEIKLF |
| Ga0209265_11117322 | 3300026308 | Soil | QKIEIITRNSSGKAVVQEFEPAQEAGPPEKAAVEPESTDDEIKLF |
| Ga0209267_11343362 | 3300026331 | Soil | ITRNSAGKAVVREFEPTQEAGPPEKAAVEPESTDDEIKLF |
| Ga0209161_100557781 | 3300026548 | Soil | ERLANAEQKIEIITRNSSGKAVVQEFEPAQEAGPPEKAAVEPESTDDEIKLF |
| Ga0207509_1009652 | 3300026816 | Soil | SAGKAVVQEFEPTQEAGPPEKPAVEPESTDDEIKLF |
| Ga0209325_10392552 | 3300027050 | Forest Soil | EIITRNSAGKAVVQEFEPAQEPGPPGKAAVESESTDDEIKLF |
| Ga0209488_110848683 | 3300027903 | Vadose Zone Soil | IITRNSAGKAVVQEFEPGQEAGPSDKTVVESESTDDEIKLF |
| Ga0247828_107739451 | 3300028587 | Soil | ITRNSTGKAVVQEFEPSQEAGPPEKAAIESESTDDEIKLF |
| Ga0307312_109919262 | 3300028828 | Soil | NSAGKAVVQEFEPAQEAGPPEKTAVESESTDDEIKLF |
| Ga0307308_101920441 | 3300028884 | Soil | IARNSAGKPVVKEFEPTQEAAATDKKIEEPESTDDEIKLF |
| Ga0307304_105106181 | 3300028885 | Soil | NTAGKAVVQEFEPAQEAGPPEKAAVESESTDDEIKLF |
| Ga0075405_122343102 | 3300030847 | Soil | NSAGKAVVQEFEPAHEAGPSEKAAVESESTDDEIKLF |
| Ga0170818_1004052422 | 3300031474 | Forest Soil | AGKAVVQEFEPAQEAAPSEKAAVESERIDAEINLF |
| Ga0310915_110861512 | 3300031573 | Soil | QKIEIITRNSAGKAVVKEFEPAQEPATPEKTAVESESTDDEIKLF |
| Ga0310813_102945072 | 3300031716 | Soil | EIITRNSAGKAVVQEFEPAQEAGPSDKTVVESESTDDEIKLF |
| Ga0310907_100293002 | 3300031847 | Soil | IEIITRNSAGKAVVQEFEPAQEAGPPEKAAVEPESTDDEIKLF |
| Ga0306923_108433622 | 3300031910 | Soil | ANAEQKIEIITRNSAGKAVVKEFEPAQETGPPEKPAIESESTDDEINLF |
| Ga0310901_102911581 | 3300031940 | Soil | QKIEIITRNSAGKAVVQEFEPAQEAGPPEKAAVEPESTDDEIKLF |
| Ga0310913_102369101 | 3300031945 | Soil | SAGKAVVKEFDPAKEPAAPEKTAIESESTDDEIKLF |
| Ga0310911_106065531 | 3300032035 | Soil | KIEIITRNSAGKAVVKEFDPAKEPAAPEKTAIESESTDDEINLF |
| Ga0307472_1000372553 | 3300032205 | Hardwood Forest Soil | AKAEQKIEIIARNSAGKPVVKEFEPTQEAAATDKKIEEPESTDDEIKLF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |