| Basic Information | |
|---|---|
| Family ID | F105999 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKCDEIRERMPDVAAGFSEPTADEGQHLASCGECAEHLKAMR |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF08281 | Sigma70_r4_2 | 93.00 |
| PF00501 | AMP-binding | 1.00 |
| PF05936 | T6SS_VasE | 1.00 |
| PF12680 | SnoaL_2 | 1.00 |
| PF10518 | TAT_signal | 1.00 |
| PF13520 | AA_permease_2 | 1.00 |
| PF00749 | tRNA-synt_1c | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG3522 | Predicted component of the type VI protein secretion system | Intracellular trafficking, secretion, and vesicular transport [U] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.00% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.00% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004609 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004610 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004972 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028445 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103794162 | 3300001593 | Forest Soil | MKCNEVRERMPDVAAGFNEPTTDEGKHLESCGECAE |
| Ga0062384_1006400541 | 3300004082 | Bog Forest Soil | MKCNCDEIRERMPEVAAGFDAPTADENEHLADCTACAEKLKEMRATMALLDE |
| Ga0062389_1039877222 | 3300004092 | Bog Forest Soil | MKCDEVRERMPDVAAGLSQATTEESRHLSGCTGCAGQLEEFRRTMA |
| Ga0058891_14540641 | 3300004104 | Forest Soil | MKCEEIRERVLDVAAGRSEPTKEESTHLASCTACAQQWKS |
| Ga0058897_111447512 | 3300004139 | Forest Soil | MKCEEIRERVLDVAAGRSEPTKEESAHLASCDACALQLKS |
| Ga0062589_1012328601 | 3300004156 | Soil | MKCEQVRERMPDVAAGLSEATAAESSHLASCTGCAEQFKAMQETMTLLDEW |
| Ga0068966_14217002 | 3300004476 | Peatlands Soil | VAERVKEEVVMNCNEIRERMPEVAAGFSETTADESKHLESCGACAEELKA |
| Ga0068958_12999652 | 3300004609 | Peatlands Soil | MKCEEIRERMPDVAAGLSQPTAEEGQHLASCAACAEQLKAMSATMALLD |
| Ga0068927_13298792 | 3300004610 | Peatlands Soil | MKCDEIRERMPDVAAGFSEPTADEGQHLASCGECAEHLKAMRATMALL |
| Ga0072325_12859452 | 3300004972 | Peatlands Soil | MNCEKIHERMPDVASGLSEFTAEESQHLARCKGCAEQLAAM |
| Ga0070711_1015116592 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCEEIRERMPDVAAGFSDITSGESDHLANCIACSKQLKTM |
| Ga0070734_100974273 | 3300005533 | Surface Soil | MKCEEIREKMIDVAAGVSQTTAEENNHLATCATCAEQL |
| Ga0070734_102811811 | 3300005533 | Surface Soil | MKCEEIRERMPDVAAGLSQPTTEDSNHLASCSACA |
| Ga0070733_107366651 | 3300005541 | Surface Soil | MKCDEIRERMPEVAAGFGEFTADEGKHLTSCGACTEKLKEIRATVALL |
| Ga0070732_101704861 | 3300005542 | Surface Soil | MKCDEIRERMPEVAAGFSPITAEEGQHLDNCVNCAEHLKSLRATMAL |
| Ga0070732_102871882 | 3300005542 | Surface Soil | MNCDEIRERMPEVTAGFGELTADEDKHLASCDACTKQWKEMRAT |
| Ga0068857_1010375242 | 3300005577 | Corn Rhizosphere | MKCEQLRERMPDVAAGLSEATAAESSHLAGCPSCAEQFKAMQETM |
| Ga0070762_106824952 | 3300005602 | Soil | MKCEEIRERMPEVAAGFSEPTVEEGKHLESCGACTEQLKAMRSTMALLD |
| Ga0075291_10632682 | 3300005884 | Rice Paddy Soil | MKCEDIRERMPDVAAGVTQPTSAESNHLASCTSCADQLKAMRETMSLLDQW |
| Ga0075029_1000484271 | 3300006052 | Watersheds | MKCDEIRERMLDVAAGLREPTAQESNHLASCSACAEQLK |
| Ga0075029_1006953942 | 3300006052 | Watersheds | MKCDEIRERMPEVAAGLAEPTAEEGQHLAGCAACAEQLK |
| Ga0075029_1008181022 | 3300006052 | Watersheds | MNCNEIRDRMPDVAAGFSEPTADESNHLKSCGACAEEMKALQATM |
| Ga0075019_105559342 | 3300006086 | Watersheds | MNCQEIRERMPEVAAGFGDLTAEESKHVESCGGCAEQMKAMRQTMAVLDEWQ |
| Ga0075015_1001145801 | 3300006102 | Watersheds | MNCDEIRERMPEVAAGFGEPTADESKHLATCVACAEQLKA |
| Ga0075030_1007647572 | 3300006162 | Watersheds | MNCNQIRERMPEVAAGFSEPTVEENKHLESCGACAEQLKAM |
| Ga0070715_102506571 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNCKEIRERMPDVAAGFSAPTADERKHLDSCGNCAEQLKGMQ |
| Ga0075021_109870802 | 3300006354 | Watersheds | MKYDCNEIRERMPDVAAGFNALTTDENQHLANCAGCA |
| Ga0102924_12658782 | 3300007982 | Iron-Sulfur Acid Spring | MKCDEIRERMPEVAAGLSPITLEEGQHLESGVNCAEHLKSLRATMALLDEWRAPEPAIRRAA |
| Ga0105237_106280612 | 3300009545 | Corn Rhizosphere | MKCDDIRERMPDVAAGVSQPTSAESNHLASCTSCADQLKAMRETMS |
| Ga0116105_12420962 | 3300009624 | Peatland | MRVKGEVVMNCNEIRERMPEVAAGFSDATADENKHLESCGACTEELKAM |
| Ga0126379_124524302 | 3300010366 | Tropical Forest Soil | MKCEEIRERMPDVAAGYSAPTADESSHLAGCTSCAEQLKGMRATLSL |
| Ga0126381_1007195311 | 3300010376 | Tropical Forest Soil | MKCNEIVERIPDVAAAFSNPTVEESAHLAACSACAEKLKAMRAT |
| Ga0138534_11104301 | 3300011061 | Peatlands Soil | MKCDEIRERMPDVAAGFSEPTADEGQHLASCGECAEHLKAMRATMALLDEWQ |
| Ga0138594_10171112 | 3300011067 | Peatlands Soil | MKCDEIRERMPDVAAGFSEPTADEGQHLASCGECAEHLKAMRA |
| Ga0138595_10424131 | 3300011071 | Peatlands Soil | MNCNEIRERMPEVAAGFSETTADESKHLKSCGACAEELKG |
| Ga0138576_12471522 | 3300011088 | Peatlands Soil | MKCNCEEIRERMPDVAAGFDALTADESQHLTGCTACTG |
| Ga0138579_13040342 | 3300011090 | Peatlands Soil | MNCNEIRERMPEVAAGFSETTADESKHLESCGACAEELKGMRATMALLDEW |
| Ga0137390_112192011 | 3300012363 | Vadose Zone Soil | MNCNEIRERMPDVAAGFGEPTADEGKHLESCGACAEQLKAM |
| Ga0181531_102782881 | 3300014169 | Bog | MNCNEIRERMPDVAAGFSEATPDDGKHLETCAACAE |
| Ga0181535_101820653 | 3300014199 | Bog | MNCNEIRERMPDVAAGFSEATPDDGKHLETCAACAEALKGMKATMAV |
| Ga0181519_100807391 | 3300014658 | Bog | MKCDEIRERMPEVAAGFGELTADESNHLASCNTCEQQLKSMRAT |
| Ga0137409_109926211 | 3300015245 | Vadose Zone Soil | MKYDCNDIRERMPDVAAGFNALTTDESQHLASCAGCTEQLKS |
| Ga0134072_101780632 | 3300015357 | Grasslands Soil | MKCEQLRERMPDVAAGLSEATAAESSHLASCISCAEQF |
| Ga0182034_114400822 | 3300016371 | Soil | MKCEEIRERMPDVAAGFSELTTEESNHLAGCAACAEQLKGMR |
| Ga0181511_12152122 | 3300016702 | Peatland | MNCNQVRERMPEVAAGFSEFTTDEGKHLESCGACAEEL |
| Ga0187802_102190602 | 3300017822 | Freshwater Sediment | MKCDEIRERMTDVAAGCSEFTADESSHLATCMGCAEQLK |
| Ga0187818_101851391 | 3300017823 | Freshwater Sediment | MNCEEIRERMPDVAAGLSQATAEEGQHLASCAACAEQLKAMSATMAL |
| Ga0187824_103987482 | 3300017927 | Freshwater Sediment | MKCEQLRERMPDVAVGLSEATAAENSHLASCTSCAEQF |
| Ga0187809_103335672 | 3300017937 | Freshwater Sediment | MKCDEIRERMPDVAAGLNQFTADENQHFESCAACAEQLKAMRATMTLLDDWHARE |
| Ga0187819_102689402 | 3300017943 | Freshwater Sediment | MKCDEIRQRIPDVAAGFSEATTEDSNHLASCGECAEKLKSMRA |
| Ga0187817_110028602 | 3300017955 | Freshwater Sediment | MKCEEIRERMVDEAAGLRPATEDESVHLASCAACAEQLNAMRA |
| Ga0187782_100932941 | 3300017975 | Tropical Peatland | MKCDEIRERMPDVAAGFAELTVEDGQHLTSCQPCTAKLK |
| Ga0187782_101801091 | 3300017975 | Tropical Peatland | MNNVLKCEEIRERMPDLAAGFGEATAGELEHLASCAA |
| Ga0187889_104847511 | 3300018023 | Peatland | MKCEEIRERMPDVAAGLSQPTAEEGQHLASCAACAEQLRAMSATM |
| Ga0187871_107095322 | 3300018042 | Peatland | MKCDEIRERMPEVAAGFGELTADESNHLASCSRCEEQLKSMR |
| Ga0187858_102547431 | 3300018057 | Peatland | MNCNEIRERMPEVAAGFSDATADENKHLESCGACTEELKAMR |
| Ga0187765_106573002 | 3300018060 | Tropical Peatland | MKCNEICERMADVAAGFGEFTADERSHLASCIGCAEQLKAMRSTMSLLDEW |
| Ga0187770_110158512 | 3300018090 | Tropical Peatland | MKYSLNCDDIRDRMPDVAAGFSKPTTEESNHLASCSACTEQLKAMRATMTLLDEWQVPEP |
| Ga0187800_11681972 | 3300019278 | Peatland | VMKCNEIRERMADVAAGFGEFTADESTHLASCIGCA |
| Ga0182025_10231431 | 3300019786 | Permafrost | MKCDEIRERMPDVAAGFSKPTIDEGMHLESCGTCAQEFEGVARDN |
| Ga0193726_11118471 | 3300020021 | Soil | MNCNQIRERMPDVAAGFSEPTTVEGNHLESCSACAEELKA |
| Ga0210396_101121994 | 3300021180 | Soil | MNCNEIRERMPEVAAGFGDATADENKHLESCGACAE |
| Ga0210393_108886171 | 3300021401 | Soil | MNCAEIRERMPDVAAGFSEPAADENKHLESCPACAEQLKSMRATMALL |
| Ga0210385_101917973 | 3300021402 | Soil | MKCDEIRERMPEVAAGFSELTTDEGKHVESCGACTE |
| Ga0210385_103018461 | 3300021402 | Soil | MKEMKCNEIRERMPEVAAGFDKLTLDEGKHLESCAAC |
| Ga0210383_111462721 | 3300021407 | Soil | MNCNEIRERMPDVAAGFSELTADEGKHLESCGACAE |
| Ga0210394_116780302 | 3300021420 | Soil | MKCDEIRERMPEVAAGFGELRADESNHLASCSTCEEQLKSMRATMSLLDEWQVP |
| Ga0213879_102593351 | 3300021439 | Bulk Soil | MNCQEIRERMPEVAAGFDALTADESKHLESCGGCSEQWKGMRQ |
| Ga0182009_103313751 | 3300021445 | Soil | MKCEQLRERMPDVAAGLSEATAAESSHLAGCPSCAEQFKAMQET |
| Ga0213852_13430762 | 3300021858 | Watersheds | LREAVMNCNEIRDRMPDVAAGFTQLTADEERHFGSCAACTEQLKSMRATM |
| Ga0242654_100601182 | 3300022726 | Soil | MNCDEIRERMPEVAAGFGEATLEEHKHLSSCADAPSN |
| Ga0242654_103915902 | 3300022726 | Soil | MGEKSLGEAVMKCDEIRERMLDVAAGFSQPTADEGKHLESCGTCAEDLRAMR |
| Ga0224545_10225402 | 3300022881 | Soil | MKCDEIRERMPDVAAGFSKPTIDEGMHLESCGTCAQELKALRATMAVLDEWQTP |
| Ga0247551_1011902 | 3300023552 | Soil | MNCNEIRERMPDVAAGFSEASPDDGKHLETCAACAEALKGMKATMAVL |
| Ga0207685_103927392 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNCKEIRERMPDVAAGFSAPTADERKHLDSCGNCAEQLKGMQATMA |
| Ga0207646_111194332 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCEEIRERMPDVAAGFSEVTTEESNHLAGCSVCTEQ |
| Ga0207726_10216481 | 3300027045 | Tropical Forest Soil | MKCDEIRERMPEVAAGFSELSADENQHLAGCQACAEQLKAMRSTMALLD |
| Ga0207780_10443562 | 3300027313 | Tropical Forest Soil | MKCEEIRERMPDVAAGFSESTTEESNHLAGCAVCAEQLKGMRATMSLLDE |
| Ga0209333_11101322 | 3300027676 | Forest Soil | MKCDEIRERMPDLAAGFSQPTRDEGKHMESCGACAQQLQALRAT |
| Ga0209040_100719111 | 3300027824 | Bog Forest Soil | MKCDEIRGRMPDVAAGFSQATAEENNHLATCEVCSEQLKAMRD |
| Ga0209060_105429791 | 3300027826 | Surface Soil | MKCEEIREKMIDVAAGVSQTTAEENNHLATCATCAEQ |
| Ga0209167_100880183 | 3300027867 | Surface Soil | MKCDEIRERMPDMAAGFGELTADEGNHLAICSAYGTTEIV |
| Ga0209624_105535302 | 3300027895 | Forest Soil | MKCDEIRERMPDVAAGLSQATTEENRHFSSCTGCAG |
| Ga0209006_107183921 | 3300027908 | Forest Soil | MKNNCDEIRERMPEVAAGFDAATAEESQHLATCTECTEKLKEMRSTMALLDEWQ |
| Ga0209526_104848262 | 3300028047 | Forest Soil | MKCNEIHEWMPDVAAGFSEPTPDESKHLESCGACAQQLKEMRATMTLLDG |
| Ga0189899_1045861 | 3300028445 | Peatlands Soil | MKCDEIRERMPDVAAGFSEPTADEGQHLASCGECAEHLKAMR |
| Ga0265338_100229961 | 3300028800 | Rhizosphere | MKCDEIRERIPDVAAGFSEPTADESQHLASCNDCAEQL |
| Ga0302221_101254573 | 3300028806 | Palsa | MKCDEIRERMPDVAAGFSEATAEESSHLAGCGACSEQLKAMQSTMALLDEWQTP |
| Ga0311340_101530824 | 3300029943 | Palsa | MNCNEIRERMPDVAAGFSAATLDDGKHLETCGACAEELKAMRATMALLDEWKV |
| Ga0307496_100652312 | 3300031200 | Soil | MKCQDIREKMSDVAAGFSEPTADESNHLATCNVCAEQLK |
| Ga0307476_104170612 | 3300031715 | Hardwood Forest Soil | MKCDEIRERMPDMAAGYSQPTGDEGEHLESCGDCAQELKAMRETMILLDEW |
| Ga0307474_109371271 | 3300031718 | Hardwood Forest Soil | MKCDEILERMPEVAAGFSELTTDEGKHVESCGACSEKLKAMRA |
| Ga0307477_101696632 | 3300031753 | Hardwood Forest Soil | MKCDEIRERMPDMAAGYSQPTGDEGEHLESCGDCAQELKA |
| Ga0307479_106626282 | 3300031962 | Hardwood Forest Soil | MTCNEIRERMPDVAAGLDQLTADESTHLASCKECAGKLGE |
| Ga0307479_115626751 | 3300031962 | Hardwood Forest Soil | MKCDEIRERMPDVAAGFCEPTADEGRHLESCGACAQQLKAMRATMALLDEWKVKEPS |
| Ga0311301_108550051 | 3300032160 | Peatlands Soil | MKCEEIRERMPDVAAGLSQPTAEEGQHLASCAACAEQLKAMSATMALL |
| Ga0311301_110173132 | 3300032160 | Peatlands Soil | LAKSVKGEVVMNCNEIRERMPEVAAGFSEPTADEAKHLENCGACAEQLKGM |
| Ga0335075_107353111 | 3300032896 | Soil | MKCDEIRERLPDVAAGLSQATAEETQHLSSCGGCADQLKE |
| Ga0326726_121787772 | 3300033433 | Peat Soil | MKCEEVRERMPDVAAGFSEPTADESQHLASCGECSEQLKAM |
| Ga0370492_0306072_1_150 | 3300034282 | Untreated Peat Soil | MNCDEIRERMPDVAAGFSEPTADENKHLESCAACVEQLTSMRATMALLDE |
| ⦗Top⦘ |