NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105978

Metagenome Family F105978

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105978
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 47 residues
Representative Sequence MKRTILLLFALAASPASVLCGDRHIAFERDQAVWIANLDGTGEKKIA
Number of Associated Samples 90
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.00 %
% of genes near scaffold ends (potentially truncated) 98.00 %
% of genes from short scaffolds (< 2000 bps) 94.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(23.000 % of family members)
Environment Ontology (ENVO) Unclassified
(37.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 20.00%    β-sheet: 21.33%    Coil/Unstructured: 58.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF12412DUF3667 35.00
PF13520AA_permease_2 2.00
PF14870PSII_BNR 1.00
PF03631Virul_fac_BrkB 1.00
PF02779Transket_pyr 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908044|A5_c1_ConsensusfromContig25017All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae803Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig299867All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium721Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10034839All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1170Open in IMG/M
3300004114|Ga0062593_102420654All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300004480|Ga0062592_102039348All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300005175|Ga0066673_10904930All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia502Open in IMG/M
3300005180|Ga0066685_10989492All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005294|Ga0065705_10051093All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1320Open in IMG/M
3300005295|Ga0065707_10879921All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005339|Ga0070660_100158355All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1824Open in IMG/M
3300005340|Ga0070689_101757582All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005366|Ga0070659_100006783All Organisms → cellular organisms → Bacteria8286Open in IMG/M
3300005366|Ga0070659_101852039All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005367|Ga0070667_102318951All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005436|Ga0070713_100717032All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium955Open in IMG/M
3300005439|Ga0070711_102058047All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300005440|Ga0070705_101787040All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia521Open in IMG/M
3300005446|Ga0066686_10139139All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300005454|Ga0066687_10149022All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300005454|Ga0066687_10701756All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia602Open in IMG/M
3300005467|Ga0070706_101222967All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium690Open in IMG/M
3300005468|Ga0070707_101341421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia682Open in IMG/M
3300005518|Ga0070699_100980521All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia775Open in IMG/M
3300005548|Ga0070665_102196701All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005554|Ga0066661_10700694All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia595Open in IMG/M
3300005558|Ga0066698_10341997All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1034Open in IMG/M
3300005558|Ga0066698_10779186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia622Open in IMG/M
3300005576|Ga0066708_10011770All Organisms → cellular organisms → Bacteria4159Open in IMG/M
3300005615|Ga0070702_100651312All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia797Open in IMG/M
3300005983|Ga0081540_1352958All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium503Open in IMG/M
3300006028|Ga0070717_10691494All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia927Open in IMG/M
3300006031|Ga0066651_10437824All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium694Open in IMG/M
3300006163|Ga0070715_10490131All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium701Open in IMG/M
3300009012|Ga0066710_100734670All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1508Open in IMG/M
3300010040|Ga0126308_10151482All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1464Open in IMG/M
3300010042|Ga0126314_11247190All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium556Open in IMG/M
3300010376|Ga0126381_100117500All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3434Open in IMG/M
3300010398|Ga0126383_10317065All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1565Open in IMG/M
3300011271|Ga0137393_10405766All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1167Open in IMG/M
3300011444|Ga0137463_1073803All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1278Open in IMG/M
3300012198|Ga0137364_10635819All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium804Open in IMG/M
3300012199|Ga0137383_10024113All Organisms → cellular organisms → Bacteria4236Open in IMG/M
3300012199|Ga0137383_11362765All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia503Open in IMG/M
3300012200|Ga0137382_10808439All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium675Open in IMG/M
3300012202|Ga0137363_10402145All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1141Open in IMG/M
3300012203|Ga0137399_11056386All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia684Open in IMG/M
3300012205|Ga0137362_11626341All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia533Open in IMG/M
3300012207|Ga0137381_10467184All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1101Open in IMG/M
3300012208|Ga0137376_10069504All Organisms → cellular organisms → Bacteria2927Open in IMG/M
3300012208|Ga0137376_11425107All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia584Open in IMG/M
3300012208|Ga0137376_11751498All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
3300012210|Ga0137378_11194645All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae676Open in IMG/M
3300012285|Ga0137370_10181826All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1228Open in IMG/M
3300012349|Ga0137387_10618126All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium785Open in IMG/M
3300012356|Ga0137371_11338720All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium528Open in IMG/M
3300012532|Ga0137373_10824502All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium684Open in IMG/M
3300012582|Ga0137358_10181410All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1436Open in IMG/M
3300012582|Ga0137358_10441649All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium879Open in IMG/M
3300012582|Ga0137358_10475488All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae843Open in IMG/M
3300012683|Ga0137398_10226214All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1240Open in IMG/M
3300012902|Ga0157291_10228440All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium606Open in IMG/M
3300012912|Ga0157306_10125172All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium780Open in IMG/M
3300012917|Ga0137395_10556627All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia828Open in IMG/M
3300012971|Ga0126369_10722071All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1075Open in IMG/M
3300012986|Ga0164304_10163969All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1414Open in IMG/M
3300014157|Ga0134078_10164352All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia882Open in IMG/M
3300015053|Ga0137405_1310550All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1115Open in IMG/M
3300015374|Ga0132255_105634451All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium530Open in IMG/M
3300016294|Ga0182041_10431870All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1128Open in IMG/M
3300016357|Ga0182032_10287880All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1292Open in IMG/M
3300016357|Ga0182032_11861756All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium526Open in IMG/M
3300018073|Ga0184624_10454699All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium562Open in IMG/M
3300018431|Ga0066655_11159262All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia545Open in IMG/M
3300019867|Ga0193704_1031909All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1061Open in IMG/M
3300020000|Ga0193692_1059938All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium853Open in IMG/M
3300020006|Ga0193735_1051931All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1216Open in IMG/M
3300020008|Ga0193757_1004839All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1198Open in IMG/M
3300020018|Ga0193721_1164498All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300020059|Ga0193745_1029817All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1197Open in IMG/M
3300022694|Ga0222623_10248450All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium687Open in IMG/M
3300022756|Ga0222622_10061356All Organisms → cellular organisms → Bacteria2171Open in IMG/M
3300025898|Ga0207692_10235297All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1092Open in IMG/M
3300025905|Ga0207685_10525724All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium626Open in IMG/M
3300025906|Ga0207699_10401577All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia976Open in IMG/M
3300025912|Ga0207707_11105100All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium646Open in IMG/M
3300025916|Ga0207663_11488724All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium545Open in IMG/M
3300025918|Ga0207662_10106133All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1746Open in IMG/M
3300026548|Ga0209161_10159410All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1296Open in IMG/M
3300028711|Ga0307293_10055934All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1229Open in IMG/M
3300028793|Ga0307299_10076985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1239Open in IMG/M
3300031128|Ga0170823_17189987All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031231|Ga0170824_103561134All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1175Open in IMG/M
3300031446|Ga0170820_13094562All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1249Open in IMG/M
3300031446|Ga0170820_14815531All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1024Open in IMG/M
3300031474|Ga0170818_108116834All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium513Open in IMG/M
3300031562|Ga0310886_10366858All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia841Open in IMG/M
3300031890|Ga0306925_11676572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia615Open in IMG/M
3300032074|Ga0308173_11427765All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium650Open in IMG/M
3300032180|Ga0307471_103014230All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium597Open in IMG/M
3300032205|Ga0307472_102164989All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium560Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil23.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere13.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.00%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020008Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A5_c1_001304502124908044SoilMKRTILLLFALAASPASVFCGDRHIAFERDQAVWIANLDGTGEKKIADGIFPAISPPPTVRI
KansclcFeb2_144588802124908045SoilMIRIIALLFAVAACPASVFCGDRHVAFERNDAIYIVNLDGTGEKKIADGI
AF_2010_repII_A001DRAFT_1003483923300000793Forest SoilMKRTILLLCALAAPHVSVFCSDRHIAFERDQAVWIANLDGTGEKKIADGIFPAISPD
Ga0062593_10242065413300004114SoilMKRAILLLFALATSHASVFCGDRQISFERDQAVWLANLDGTGEKKIADGIFPAI
Ga0062592_10203934813300004480SoilMKRMILLLFALAVLPVSVFCSDRQIAFERDQAVWVANFDGTNEKKIADGIFPAISPD
Ga0066673_1090493013300005175SoilMKHLILFGLALIVSPASVFCGDRHIAFERNQAVWIANLDGTGEKKI
Ga0066685_1098949213300005180SoilMRRIIALLFALGVSRASVFCGDRHIAFERNDAIYIANLDGTGEKKIADGIFPAI
Ga0065705_1005109313300005294Switchgrass RhizosphereMKTMLLVFALAASPASVFCGDRHIAFERDQTVWLANLDGTGEKKVADGIFPAISP
Ga0065707_1087992113300005295Switchgrass RhizosphereMKRAILLLFALAASPASVFCGDRHIAFERDQAVWLANLDGTGEKKIADGIFPAI
Ga0070660_10015835533300005339Corn RhizosphereMKRTILLLFALAASAASVFCGDRQIAFERDQAVWIANLDGTTEK
Ga0070689_10175758213300005340Switchgrass RhizosphereMKRTILLLFALAASPASVFCGDRQIAFERDQAVWIANLDGTGEKKIADGIFPAIS
Ga0070659_10000678313300005366Corn RhizosphereMKRTILLLFALAASAASVFCGDRQIAFERDQAVWIANLDGTTEKKIADGIFPAI
Ga0070659_10185203923300005366Corn RhizosphereMKRTILLLFALAASPASVLCGDRHIAFERDQAVWLANLDGTGEKKIADGIFP
Ga0070667_10231895123300005367Switchgrass RhizosphereMRRTILLLFALAAYPASVFCADRYIAFERDQAVWLANLDGTGEKKIADGIFPAI
Ga0070713_10071703213300005436Corn, Switchgrass And Miscanthus RhizosphereMKRTILLFFALAASSASVLCGDRHIAFERDQAVWIANLDGT
Ga0070711_10205804723300005439Corn, Switchgrass And Miscanthus RhizosphereMKRTILLFFALAASSASVLCGDRHIAFERDQAVWIANLDGTGEKK
Ga0070705_10178704013300005440Corn, Switchgrass And Miscanthus RhizosphereMKTIILLGFTLAFSSASGFCADRQIAFERDQAVWIAKLDGTGEKKIADGIF
Ga0066686_1013913933300005446SoilMKKIILLAFVLAASPASVFCGDRHIAFERDQAVWIAKLDGTGEKKIADGIFPAIS
Ga0066687_1014902223300005454SoilMKKIILLAFVLATSPASVFCGDRHIAFERDQAVWIANLDGTGEKKIADGIFPAI
Ga0066687_1070175623300005454SoilMKNVILFGLALIVSSASVFCGDRHIAFERNQAVWIANLDGT
Ga0070706_10122296723300005467Corn, Switchgrass And Miscanthus RhizosphereMKRTILLLLALAASSASVFCGDRHIAFERDQAVWIANLDGTGEK
Ga0070707_10134142113300005468Corn, Switchgrass And Miscanthus RhizosphereMKTIILLGFTLAFSSASGFCADRQIAFERDQAVWIAKLDGT
Ga0070699_10098052113300005518Corn, Switchgrass And Miscanthus RhizosphereMKTIILLGFTLAFSSASGFCADRQIAFERDQAVWIAKLDGTGEKKIADGIFP
Ga0070665_10219670113300005548Switchgrass RhizosphereMKRTILLLFALAASPASVFCGDRQIAFERDQAVWIANLDGTGEKKIADGIFPAISPD
Ga0066661_1070069423300005554SoilMRRIIALLFAVAASPASVFCGDRHIAFERNDAIYIANLD
Ga0066698_1034199713300005558SoilMKKIILLGFALAFSPTSGFCGDRQIAFERDQAVWIAKLDGT
Ga0066698_1077918623300005558SoilMKKIILLGFTLAFSSASGFCADRQIAFERDQAVWIAK
Ga0066708_1001177013300005576SoilMRRIIALLFALAASPASVFCGDRHVAFERNDAIYIANLDGTGEKKIADGIFPAISPDG
Ga0070702_10065131213300005615Corn, Switchgrass And Miscanthus RhizosphereMKRTILLLFALAASAASVFCGDRQIAFERDQAVWIANLDG
Ga0081540_135295823300005983Tabebuia Heterophylla RhizosphereMNRILLVLIALAALPASLFCSDRQIAFERDQAVWIANLDGTSEKKIA
Ga0070717_1069149413300006028Corn, Switchgrass And Miscanthus RhizosphereMKRAILLLFVLAAAPASVFCGDRHIAFERDQAVWIAN
Ga0066651_1043782423300006031SoilMRRIIALLFALAASPASVFCGDRHIAFERNDAIYIANLDGTGEKKIADGI
Ga0070715_1049013123300006163Corn, Switchgrass And Miscanthus RhizosphereMKRTILLLFALAASPASVFCGERHIAFERDQAVWLANLDGT
Ga0066710_10073467033300009012Grasslands SoilMKKIILLGFTLAFSSASGFCADRQIAFERDQAVWIAKLDGTGERKIA
Ga0126308_1015148213300010040Serpentine SoilMKRTILLLLALAAAPASAFCGDRHIAFERDLAVWIANLAG
Ga0126314_1124719013300010042Serpentine SoilMKRISLLLVALAVSPSSLFSDNRHLAFERDQAVWIANLD
Ga0126381_10011750043300010376Tropical Forest SoilMKRKILVLFALAASSTSGFCGDRQIAFERDQAVWIAN
Ga0126383_1031706533300010398Tropical Forest SoilMKKIILLGFALALSPASGFCGDRQIAFERDQAVWI
Ga0137393_1040576613300011271Vadose Zone SoilMRRVIALLFALAASPASIFCGDRHVAFERNDAIYIANLDGTGEKKIADGIFPAISPDGT
Ga0137463_107380313300011444SoilMKRMIVLLFALAASSASVFCGDRHIAFERDQAVWIANLDGTGEKKIADGIFPAISP
Ga0137364_1063581923300012198Vadose Zone SoilMRRIIALLFAVAASPASVFCGDRHIAFERNDAIYIA
Ga0137383_1002411353300012199Vadose Zone SoilMRRIIALLFALAASPASVFCGDRHVAFERNDAIYIANLD
Ga0137383_1136276513300012199Vadose Zone SoilMKKIIALGLALLVSPASVFCGDRHIAFERNQAVWIANLDGTGEKKIADGIF
Ga0137382_1080843913300012200Vadose Zone SoilMKRTILLLFALAASPAPVFCADRHIAFERDQAVWIANLDGTGEKKIADGIFPAIS
Ga0137363_1040214523300012202Vadose Zone SoilMKRIIVLLFALAASPASVFCGDRHIAFERDQAVWIAN
Ga0137399_1105638623300012203Vadose Zone SoilMKKIILLGFTLAFSSASGFCGDRHIAFERDQAVWIAKLDGTAEKKIADGIFP
Ga0137362_1162634123300012205Vadose Zone SoilMKKIILLGFVLAFSSASGFCADRQIAFERDQAVWIAKLDGTGEKKIADGIFP
Ga0137381_1046718413300012207Vadose Zone SoilMIRIIALLFALAACPASVFCGDRHVAFERNDAIYIANL
Ga0137376_1006950413300012208Vadose Zone SoilMRRIIALLFAVAASPASVFCGDRHIAFERNDAIYIANLDGT
Ga0137376_1142510713300012208Vadose Zone SoilMKKIILLGFALAFSPTSGFCGDRQIAFERDRAVWIAK
Ga0137376_1175149823300012208Vadose Zone SoilMKRMILLPFALAASSASVFCGDRHIAFERDQAVWIANLDGTGEKKIADGIFPAIS
Ga0137378_1119464513300012210Vadose Zone SoilVKKIGLLAVVLVIPPAVAFCGDQHVAFERNNAVYLANLNGTGERKIADGIFPAISPDGTR
Ga0137370_1018182613300012285Vadose Zone SoilMKKIILLGFALAFSPTSGFCGDRQIAFERDRSVWIAKLVGTGEKKIADGI
Ga0137387_1061812613300012349Vadose Zone SoilMIRIIALLFALAASPASVFCGDRHVAFERNDAIYIANLD
Ga0137371_1133872013300012356Vadose Zone SoilMAMVRTILLLFALAASSPSVLCGDRNIAFERDQAVWIANLDGTGEKKIADGI
Ga0137373_1082450213300012532Vadose Zone SoilMKRTILLLFALAASSASVLCGDRHIAFERDQAVWLANL
Ga0137358_1018141013300012582Vadose Zone SoilMKRTILLLFALAASSASVFCGDRHIAFERDQAVWIANLDGTGEKKIADGIFPAI
Ga0137358_1044164923300012582Vadose Zone SoilMKKIISLGFVLASLSAAFAGDRHIAFERNQAVWIANLDGTGEKKIADGTF
Ga0137358_1047548823300012582Vadose Zone SoilMKKIILLAFVLANSSASVFCSDRHIAFERNQAVWIANLDGTGEKKIADGTFPAISPDGT
Ga0137398_1022621413300012683Vadose Zone SoilMKKIILLGFTLAFSSASGFCGDRHIAFERDQAVWIAKLDGTGEKKIADG
Ga0157291_1022844023300012902SoilMKRMILLLFALAVLPVSVFCSDRQIAFERDQAVWVANFDG
Ga0157306_1012517223300012912SoilMKRMILLLFALAVLPVSVFCSDRQIAFERDQAVWVANFD
Ga0137395_1055662713300012917Vadose Zone SoilMKKIILLGFTLAFSSASGFCADRQIAFERDQAVWIAKLDG
Ga0126369_1072207113300012971Tropical Forest SoilMKRIFLVLVALAASPASVFCGERHIAFERNDAVYI
Ga0164304_1016396913300012986SoilMNRTILLLFALAASSTSVFCGDRHIAFERDQAVWLANLEGTGEKKIAD
Ga0134078_1016435213300014157Grasslands SoilMKKIIVLGFALVFSPSLVFCGDRHIAFERNQAVWIANLDGTG
Ga0137405_131055023300015053Vadose Zone SoilMKRTILLLFALAAAPASVFCGDRHIAFERDRTVWIANLDGTGEKKIADGIFP
Ga0132255_10563445123300015374Arabidopsis RhizosphereMKRMILLLFALAASSASVLCGDRQIAFERDQAVWLANLDG
Ga0182041_1043187013300016294SoilMKRTILLLCALAAAPVSVFCGDRHIAFERDQAVWIAN
Ga0182032_1028788023300016357SoilMRAMVAFALAASPSSIFCGDRQIAFERDQAVWIAHLDGTGE
Ga0182032_1186175623300016357SoilMKRVVLFLFAFAMSIVSAFCSDRHIAFERDQAVWIANLDGTGEKKI
Ga0184624_1045469923300018073Groundwater SedimentMKRTILLLFALAASPASVLCGDRHIAFERDQAVWIANLDGTGEKKIA
Ga0066655_1115926223300018431Grasslands SoilMKKIILLGFALAFSPTSGFCGDRQIAFERGQAVWIAKLDGTGEKKIAEGIF
Ga0193704_103190913300019867SoilMKRMILLLLALAASPISVFCGDRHIAFEREQAVWIANLDGTGEKKIADGIFPAILAGWNSHRS
Ga0193692_105993813300020000SoilMKRTILLLFALAAAPASVLCGDRHIAFERDQAVWIANLDG
Ga0193735_105193123300020006SoilMKRTILLLFALAASSASVFCGDRHIAFERDQAVWIANLDGTGEKKIADGIFPAISPDG
Ga0193757_100483923300020008SoilMKRTILLLFALAAAPASVLCGDRHIAFERDQAVWIANLDGTGEKKIADGIFPAISPD
Ga0193721_116449813300020018SoilMKRTILLLFALAASPASLFCDNRHIAFERDQAVWIANLDGTGEKKIADGIFPAI
Ga0193745_102981723300020059SoilMKRTILLLFALAASPASVLCGDRHIAFERDQAVWLANLDGTGEKKIAD
Ga0222623_1024845023300022694Groundwater SedimentMKRMILLLFALAASPASLFCDSRHIAFERDQAVWIANLDGTGEKKIADGIFPAISPDG
Ga0222622_1006135613300022756Groundwater SedimentMKRMILLLLALAASPISVFCGDRHIAFERDQAVWL
Ga0207692_1023529713300025898Corn, Switchgrass And Miscanthus RhizosphereMKRTILLFFALAASSASVLCGDRHIAFERDQAVWLANLD
Ga0207685_1052572423300025905Corn, Switchgrass And Miscanthus RhizosphereMNRMILLLFVLAASPASVLCGDRHIAFERDQAVWLANLDGTGEKKIADGIFPAISPD
Ga0207699_1040157723300025906Corn, Switchgrass And Miscanthus RhizosphereMKKTILLLFALAASPASVFCGDRHIAFERDQAVWIANLDGTGEK
Ga0207707_1110510023300025912Corn RhizosphereMTRTLVLLFALAAFPASLFSDNRHIAFEREQAVWIANLDGTAEKKIA
Ga0207663_1148872413300025916Corn, Switchgrass And Miscanthus RhizosphereMKRMIFLLFALAASPASVLCGDRHIAFERDQAVWLA
Ga0207662_1010613333300025918Switchgrass RhizosphereMKRTILLLFALAASPASVLCGDRHIAFERDQAVWIANLD
Ga0209161_1015941023300026548SoilMRRIIALLFALAASPASVFCGDRHVAFERNDAIYIANLDGT
Ga0307293_1005593423300028711SoilMKRMILLLLALAASPISVFCGDRHIAFEREQAVWIANLDGTGEKKIADGIFP
Ga0307299_1007698523300028793SoilMKRMILLLLALAASPISVFCGDRHIAFERDQAVWIANLDGTGE
Ga0170823_1718998713300031128Forest SoilLKRTILLLFALAASHASVFCGERHIAFERDQAVWLANLDGTGEKKIA
Ga0170824_10356113423300031231Forest SoilLKRTILLLFALAASPASVFCGERHIAFERDQAVWLANLDGTGEKKIADG
Ga0170820_1309456213300031446Forest SoilMKTMLLLFALAASPASVFCGDRHIAFERDQAVWLANLDGPREKKI
Ga0170820_1481553113300031446Forest SoilMKRTILLLFALAASHASVFCGERHIAFERDQAVWLANLDGTGEKKIADGI
Ga0170818_10811683423300031474Forest SoilMKRTMLLLFALAAFPSSLFCGDQHVGFEREQAVWIANLDGTGEKKIADGIFPAISP
Ga0310886_1036685813300031562SoilMKRAILLLFALAASHASVFRGDRQIAFERDQAVWLANLDGTGEKKIAD
Ga0306925_1167657223300031890SoilMKKIILLGFVLAISPASVFCGDRHIAFERDQAVWIANLDGTG
Ga0308173_1142776523300032074SoilMAMKRISLLLVALAVSPSSLFSDNRHIAFERDQAVWIANLDGTGEKKLRT
Ga0307471_10301423023300032180Hardwood Forest SoilMKRAILLFFALAASPASLFCDDRHIAFERDQAVWIANLDGTGEKKIADGI
Ga0307472_10216498913300032205Hardwood Forest SoilMKRTAFFLLALAASPASVFCGDRHMAFERDQAVWIANLDGIGEKKVA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.