| Basic Information | |
|---|---|
| Family ID | F105976 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 79.00 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00210 | Ferritin | 22.00 |
| PF02517 | Rce1-like | 14.00 |
| PF00072 | Response_reg | 8.00 |
| PF01797 | Y1_Tnp | 6.00 |
| PF00005 | ABC_tran | 3.00 |
| PF01161 | PBP | 2.00 |
| PF02518 | HATPase_c | 2.00 |
| PF13551 | HTH_29 | 1.00 |
| PF06071 | YchF-GTPase_C | 1.00 |
| PF01381 | HTH_3 | 1.00 |
| PF00291 | PALP | 1.00 |
| PF01712 | dNK | 1.00 |
| PF02927 | CelD_N | 1.00 |
| PF00809 | Pterin_bind | 1.00 |
| PF05977 | MFS_3 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 14.00 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 14.00 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 6.00 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 2.00 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 1.00 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.00 % |
| Unclassified | root | N/A | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004082|Ga0062384_100022688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2696 | Open in IMG/M |
| 3300005434|Ga0070709_10106368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1878 | Open in IMG/M |
| 3300005554|Ga0066661_10315602 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005591|Ga0070761_10045418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2469 | Open in IMG/M |
| 3300005591|Ga0070761_10058816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2169 | Open in IMG/M |
| 3300005610|Ga0070763_10047437 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300005614|Ga0068856_100526015 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300005614|Ga0068856_101797212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300005712|Ga0070764_10645399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 648 | Open in IMG/M |
| 3300005712|Ga0070764_10736862 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006162|Ga0075030_100102639 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300006162|Ga0075030_100927333 | Not Available | 686 | Open in IMG/M |
| 3300006163|Ga0070715_10508639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 691 | Open in IMG/M |
| 3300006176|Ga0070765_101214507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 712 | Open in IMG/M |
| 3300006796|Ga0066665_10778304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300006854|Ga0075425_102239208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300009038|Ga0099829_10016773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4929 | Open in IMG/M |
| 3300009090|Ga0099827_10437930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300009552|Ga0116138_1187110 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300009646|Ga0116132_1090264 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300009792|Ga0126374_11103785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300010048|Ga0126373_11390961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 767 | Open in IMG/M |
| 3300010048|Ga0126373_11918064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 655 | Open in IMG/M |
| 3300010048|Ga0126373_11965030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 648 | Open in IMG/M |
| 3300010358|Ga0126370_11930603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 575 | Open in IMG/M |
| 3300010937|Ga0137776_1169295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter lindaniclasticus | 574 | Open in IMG/M |
| 3300011120|Ga0150983_11063359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 677 | Open in IMG/M |
| 3300011269|Ga0137392_10039234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3497 | Open in IMG/M |
| 3300011269|Ga0137392_10361314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1203 | Open in IMG/M |
| 3300012199|Ga0137383_11282651 | Not Available | 523 | Open in IMG/M |
| 3300012206|Ga0137380_10648411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300012210|Ga0137378_10136133 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300012357|Ga0137384_11421047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 542 | Open in IMG/M |
| 3300012359|Ga0137385_10294516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1397 | Open in IMG/M |
| 3300012683|Ga0137398_10832550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300012930|Ga0137407_10077178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2795 | Open in IMG/M |
| 3300012960|Ga0164301_11222867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300012989|Ga0164305_10231527 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300013307|Ga0157372_12040148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300014158|Ga0181521_10064239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2428 | Open in IMG/M |
| 3300014325|Ga0163163_10939820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300014654|Ga0181525_10651661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300015374|Ga0132255_105261537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 548 | Open in IMG/M |
| 3300016404|Ga0182037_10525107 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300017934|Ga0187803_10026633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2302 | Open in IMG/M |
| 3300017946|Ga0187879_10435960 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300017948|Ga0187847_10663485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300017961|Ga0187778_10275854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
| 3300017961|Ga0187778_11271484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 517 | Open in IMG/M |
| 3300017970|Ga0187783_11310689 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017975|Ga0187782_11074077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300017975|Ga0187782_11223850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 588 | Open in IMG/M |
| 3300018007|Ga0187805_10009206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 4107 | Open in IMG/M |
| 3300018007|Ga0187805_10407694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 632 | Open in IMG/M |
| 3300018038|Ga0187855_10428466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 771 | Open in IMG/M |
| 3300018043|Ga0187887_10488982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 726 | Open in IMG/M |
| 3300018088|Ga0187771_10878152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300021171|Ga0210405_10903760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300021178|Ga0210408_11175692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300021180|Ga0210396_10711442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300021180|Ga0210396_11041374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300021406|Ga0210386_11507460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 560 | Open in IMG/M |
| 3300021420|Ga0210394_10975024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 735 | Open in IMG/M |
| 3300021432|Ga0210384_10765050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300021474|Ga0210390_10281493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1408 | Open in IMG/M |
| 3300021477|Ga0210398_11300201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300021477|Ga0210398_11498317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 525 | Open in IMG/M |
| 3300021478|Ga0210402_10635630 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300021478|Ga0210402_10756576 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300021560|Ga0126371_12900742 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021861|Ga0213853_10005622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300021861|Ga0213853_11468026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1035 | Open in IMG/M |
| 3300022509|Ga0242649_1055049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 568 | Open in IMG/M |
| 3300024295|Ga0224556_1046089 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300025906|Ga0207699_10030151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3033 | Open in IMG/M |
| 3300025928|Ga0207700_11610116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 574 | Open in IMG/M |
| 3300025929|Ga0207664_11526992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300026078|Ga0207702_11630232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300027869|Ga0209579_10139661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1290 | Open in IMG/M |
| 3300027884|Ga0209275_10087356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1573 | Open in IMG/M |
| 3300027884|Ga0209275_10409997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 765 | Open in IMG/M |
| 3300027889|Ga0209380_10334589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300027895|Ga0209624_10129209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1663 | Open in IMG/M |
| 3300027908|Ga0209006_10024037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5518 | Open in IMG/M |
| 3300028906|Ga0308309_11549337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 565 | Open in IMG/M |
| 3300029951|Ga0311371_10072757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5642 | Open in IMG/M |
| 3300030058|Ga0302179_10016725 | All Organisms → cellular organisms → Bacteria | 3632 | Open in IMG/M |
| 3300030509|Ga0302183_10375426 | Not Available | 546 | Open in IMG/M |
| 3300030509|Ga0302183_10389421 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300030618|Ga0311354_10032009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6317 | Open in IMG/M |
| 3300030743|Ga0265461_14028329 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031708|Ga0310686_112244213 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300031708|Ga0310686_117098646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2901 | Open in IMG/M |
| 3300031718|Ga0307474_10221009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1445 | Open in IMG/M |
| 3300031754|Ga0307475_10700587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300031823|Ga0307478_10065417 | All Organisms → cellular organisms → Bacteria | 2734 | Open in IMG/M |
| 3300031954|Ga0306926_11899216 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300032805|Ga0335078_10153627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3253 | Open in IMG/M |
| 3300032895|Ga0335074_10315559 | Not Available | 1772 | Open in IMG/M |
| 3300033004|Ga0335084_10006421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11694 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062384_1000226881 | 3300004082 | Bog Forest Soil | LPISIMNVMDGMRGNQEMIVSGESNVDETATAPLDYVVSGVQLLTITVK* |
| Ga0070709_101063683 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVMDGMRGNQEMIVSGESSVDETATPSLDYVVSGAQLLTVTVK* |
| Ga0066661_103156022 | 3300005554 | Soil | DGMRGNQEMIVSAESNVDETATPSLDYVVSGAQLLTVTIK* |
| Ga0070761_100454181 | 3300005591 | Soil | TLPISIMNVMDGMRGNQEMIVSGESNVDETATAPLDYVVSGVQLLTITVK* |
| Ga0070761_100588163 | 3300005591 | Soil | QEMIVNGESSVDETATPPLDYVVSGAQLLTVTVK* |
| Ga0070763_100474371 | 3300005610 | Soil | PISIMNVMDGMRGNQEMVVSGESSVDETATAPLDYVVSGVQLLTITVK* |
| Ga0068856_1005260152 | 3300005614 | Corn Rhizosphere | RGNQEMIVSGESNVDETATPSLDYVVSGAQLLTITIK* |
| Ga0068856_1017972122 | 3300005614 | Corn Rhizosphere | MRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTITIK* |
| Ga0070764_106453992 | 3300005712 | Soil | MNVMDGMRGNQEMIVSGESNVDETATAPLDYVVSGVQLLTITVK* |
| Ga0070764_107368622 | 3300005712 | Soil | MRGNQEMIVSGESNVDETATAALDYVVSGAQLLTVTVK* |
| Ga0075030_1001026393 | 3300006162 | Watersheds | MNVMDGMRGNQEMIVSGESNVDETSTPPLDYVVSGAQLLTVTVK* |
| Ga0075030_1009273332 | 3300006162 | Watersheds | QDMVVLGESSVSEASTDPLDYVVSGAQMLTINIK* |
| Ga0070715_105086392 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGMRGNQEMIVSGESNVDETSTPSLDYVVSGAQLLTVTVK* |
| Ga0070765_1012145072 | 3300006176 | Soil | VMDGMRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK* |
| Ga0066665_107783042 | 3300006796 | Soil | RGTQEMVVLGESSVNETSSQALDYVVSGAQVLTITVK* |
| Ga0075425_1022392081 | 3300006854 | Populus Rhizosphere | TQDMTVLGESSVSETSTKPLDYVVSGAQLLSITIK* |
| Ga0099829_100167731 | 3300009038 | Vadose Zone Soil | TQEMVVLNESSVNEASTEPLDYVVAGAQMLTVYVK* |
| Ga0099827_104379301 | 3300009090 | Vadose Zone Soil | NVMDGLHGTQEMVVRGESAVSETTTPALDFVVSGAQLLTIAIK* |
| Ga0116138_11871101 | 3300009552 | Peatland | MRGNQEMIVSGESNVDETATAPLDYVVSGAQLLMVTVK* |
| Ga0116132_10902642 | 3300009646 | Peatland | SIMNVMDGMRGNQEMIVSGESNVDETATAPLDYVVSGAQLLMVTVK* |
| Ga0126374_111037852 | 3300009792 | Tropical Forest Soil | GTQEMVVLGESSVTEVATPPLDFAVAGAQILTITIK* |
| Ga0126373_113909612 | 3300010048 | Tropical Forest Soil | MNVMDGMRGNQEMVVSGESNVDETATPALDYVVSGAQLLTVTVK* |
| Ga0126373_119180641 | 3300010048 | Tropical Forest Soil | GMRGNQEMIVSGESNVDETSTPPLDFVVSGAQLLTVTVK* |
| Ga0126373_119650301 | 3300010048 | Tropical Forest Soil | MNVMDGMRGNQEMIVSGESNVDETSTPALDYVVSGAQLLTVTVK* |
| Ga0126370_119306032 | 3300010358 | Tropical Forest Soil | MDGMRGNQEMIVSGESNVDETATPALDYVVSGAQLLTVTVK* |
| Ga0137776_11692951 | 3300010937 | Sediment | MRGNQEMIVSGESSVDETATPILDYVVSGAQLLTVTVK* |
| Ga0150983_110633591 | 3300011120 | Forest Soil | NQEMIVSGESNVDETATPALDYVVSGAQLLTVTVK* |
| Ga0137392_100392341 | 3300011269 | Vadose Zone Soil | QEMVVLNESSVNEASTEPLDYVVAGAQMLTVYVK* |
| Ga0137392_103613141 | 3300011269 | Vadose Zone Soil | TQDMVVLGESSVSEASTDPLDYVVSGAQMLTISIK* |
| Ga0137383_112826511 | 3300012199 | Vadose Zone Soil | MDGMRGNQEMIVSAESNVDETATPSLDYVVSGAQLLTVTIK* |
| Ga0137380_106484112 | 3300012206 | Vadose Zone Soil | TQEMVVLGESSVNETSSQALDYAVSGAQVLTITVK* |
| Ga0137378_101361333 | 3300012210 | Vadose Zone Soil | GMRGNQEMIVSSESSVDETKTPPLDYVVSGAQLLTVTVK* |
| Ga0137384_114210471 | 3300012357 | Vadose Zone Soil | NQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK* |
| Ga0137385_102945162 | 3300012359 | Vadose Zone Soil | MEGMRTTQDMTVLGESRVSEASSPMDYVVTGQQVLNINIK* |
| Ga0137398_108325501 | 3300012683 | Vadose Zone Soil | RSTQEMSVQGESSVGEASAELDYVVSGTQVLTVTVK* |
| Ga0137407_100771781 | 3300012930 | Vadose Zone Soil | TQEMVVQNESSVNEAATGPLDYVVAGAQVLTITIK* |
| Ga0164301_112228671 | 3300012960 | Soil | TQEMIVQGESSVNEAATGPLDYVVSGAQVLTITVK* |
| Ga0164305_102315271 | 3300012989 | Soil | GMRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK* |
| Ga0157372_120401481 | 3300013307 | Corn Rhizosphere | NQEMIVSGESNVDETATPSLDYVVSGAQLLTLTIK* |
| Ga0181521_100642394 | 3300014158 | Bog | QEMTVSGESNVDETATPPLDYVVSGAQLLTVTVK* |
| Ga0163163_109398201 | 3300014325 | Switchgrass Rhizosphere | QEMIVQGESSVSEAATEPLDYVVAGAQVLTITIK* |
| Ga0181525_106516611 | 3300014654 | Bog | QEMIVSGESNVDETATAPLDYVVSGVQLLTITVK* |
| Ga0132255_1052615371 | 3300015374 | Arabidopsis Rhizosphere | QEMIVQGESSVNEAATAPLDYVVAGAQVMTITIK* |
| Ga0182037_105251071 | 3300016404 | Soil | MNVMDGMRGNQEMIVSGESKVDETATPSLDYVVSGAQLLTVTVK |
| Ga0187803_100266331 | 3300017934 | Freshwater Sediment | GMRGNQEMIVSGESNVDETATASLEYVVSGAHLLTVTVK |
| Ga0187879_104359602 | 3300017946 | Peatland | MRGNQEMIVSGESNVDETATAPLDYVVSGAQLLMVTVK |
| Ga0187847_106634851 | 3300017948 | Peatland | TQDMVVLGESSVSEASTEPLDYVVSGAQMLTINIK |
| Ga0187778_102758542 | 3300017961 | Tropical Peatland | NQDMVVSNESSLSETATGPLDYVIAGAQVLTINIK |
| Ga0187778_112714842 | 3300017961 | Tropical Peatland | GSQEMIVSGESNVDETATPPLDYVVSGAQLLTVTVK |
| Ga0187783_113106892 | 3300017970 | Tropical Peatland | MNVMDGMRGNQEMIVSGESSVDETSTPPLDYVVSGAQLLTVTVK |
| Ga0187782_110740771 | 3300017975 | Tropical Peatland | NVMDGMRGNQEMTVSGESSVDETSTPPLDYVVSGAQLLTVTVK |
| Ga0187782_112238501 | 3300017975 | Tropical Peatland | NVMDGMRGNQDMIVSGESNVDETATPPLDYVVSGAELLTVTVK |
| Ga0187805_100092061 | 3300018007 | Freshwater Sediment | NQEMIVSGESSVDETATPPLDYVVSGAQLLTVTVK |
| Ga0187805_104076942 | 3300018007 | Freshwater Sediment | MDGMRGNQEMIVSGESNVDETATPALDYVVSGAQLLTVTVK |
| Ga0187855_104284662 | 3300018038 | Peatland | GNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK |
| Ga0187887_104889821 | 3300018043 | Peatland | MDGMRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK |
| Ga0187771_108781521 | 3300018088 | Tropical Peatland | TQEMVVFGESSVNLASTEPLDYVVSGAQLLAINVR |
| Ga0210405_109037601 | 3300021171 | Soil | GNQEMIVSGESNVDETATPPLEYVVSGAQLLTVTVK |
| Ga0210408_111756921 | 3300021178 | Soil | GNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTIK |
| Ga0210396_107114421 | 3300021180 | Soil | NQEMLVSGESNVDETATAPLDYVVSGAQLLTVTVK |
| Ga0210396_110413741 | 3300021180 | Soil | RGNQEMIVSAESNVDETATPSLDYVVSGAQLLTVTIK |
| Ga0210386_115074602 | 3300021406 | Soil | PISIMNVMDGMRGNQEMVVSGESNVDETATAPLDYVVSGVQLLTITVK |
| Ga0210394_109750242 | 3300021420 | Soil | NVMDGMRGNQEMIVSGESNVDETATPALDYVVSGAQLLTVTVK |
| Ga0210384_107650501 | 3300021432 | Soil | NQEMIVSGESNVDETATPPLDYVVSGAQLLTVTVK |
| Ga0210390_102814931 | 3300021474 | Soil | GMRGNQEMVVSGESNVDETATAPLDYVVSGVQLLTITVK |
| Ga0210398_113002011 | 3300021477 | Soil | GNQEMIVSGESNVDETATAPLDYVVSGAQLLTITVK |
| Ga0210398_114983171 | 3300021477 | Soil | ISIMNVMDGMRGNQEMIVSGESNVDETATAALDYVVSGAQLLTVTVK |
| Ga0210402_106356303 | 3300021478 | Soil | GNQEMIVSGESNVDETATPPLDYVVSGAQLLTITVK |
| Ga0210402_107565761 | 3300021478 | Soil | MRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK |
| Ga0126371_129007421 | 3300021560 | Tropical Forest Soil | TLPISIMNVMDGMRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTIK |
| Ga0213853_100056221 | 3300021861 | Watersheds | MNVMDGMRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTIK |
| Ga0213853_114680261 | 3300021861 | Watersheds | TLPISIMNVMDGMRGNQEMIVSGESNVDETATPPLDYVVNGAQLLTVTVK |
| Ga0242649_10550492 | 3300022509 | Soil | GNQEMIVSGESSVDETATPPLDYVVSGAQLLTVTVK |
| Ga0224556_10460893 | 3300024295 | Soil | MPTLPISIMNVMDGMRGNQEMVVSGESNVDETATASLDYVVSGAQLLTVTVK |
| Ga0207699_100301511 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VMDGMRGNQEMIVSGESSVDETATPSLDYVVSGAQLLTVTVK |
| Ga0207700_116101161 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGNQEMIVSGESNVDETATPSLDYVVSGAQLLSVTVK |
| Ga0207664_115269921 | 3300025929 | Agricultural Soil | MRGNQEMIVSGESNVDETSTPSLDYVVSGAQLLTLTIK |
| Ga0207702_116302322 | 3300026078 | Corn Rhizosphere | EGMRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTITIK |
| Ga0209579_101396611 | 3300027869 | Surface Soil | RGTQEMVVLGESQVNEAATPPLDFAVAGAQVLTITIK |
| Ga0209275_100873563 | 3300027884 | Soil | LPISIMNVMDGMRGNQEMIVSGESNVDETATAPLDYVVSGVQLLTITVK |
| Ga0209275_104099971 | 3300027884 | Soil | PISIMNVMDGMRGNQEMIVSGESNVDETATAALDYVVSGAQLLTVTVK |
| Ga0209380_103345892 | 3300027889 | Soil | GNQEMVVSGESSVDETATAPLDYVVSGAQLLTITVK |
| Ga0209624_101292091 | 3300027895 | Forest Soil | TQEMVVQAESSVNESSTPALDYVVSGAHVLTINIK |
| Ga0209006_100240371 | 3300027908 | Forest Soil | NQEMTVSGESNVDETATPPLDYVVSGAQLLSVTVK |
| Ga0308309_115493371 | 3300028906 | Soil | GNQEMIVSGESNVDETATPALDYVVSGAQLLTVTVK |
| Ga0311371_100727573 | 3300029951 | Palsa | MNVMDGMRGNQEMIVSGESNVDETATAPLDYVVSGVQLLTITVK |
| Ga0302179_100167251 | 3300030058 | Palsa | NQEMVVSGESSVDETATAPLDYVVSGAQLLTVTVK |
| Ga0302183_103754261 | 3300030509 | Palsa | GNQEMVVSGESSVDETATAPLDYVVSGAQLLTVTVK |
| Ga0302183_103894211 | 3300030509 | Palsa | IMNVMDGMRGNQEMIVSGESNVDETATAPLDYVVSGVQLLTITVK |
| Ga0311354_100320096 | 3300030618 | Palsa | MPTLPISIMNVMDGMRGNQEMIVSGESNVDETATAPLDYVVSGVQLLTITVK |
| Ga0265461_140283292 | 3300030743 | Soil | MNVMDGMRGNQEMVVSGESNVDETATAPLDYVVSGAQLLTIT |
| Ga0310686_1122442133 | 3300031708 | Soil | GNQEMVVSGESSVDETATAPLDYVVSGVQLLTVTVK |
| Ga0310686_1170986461 | 3300031708 | Soil | GNQEMVVSGESSVDETATAPLDYVVSGVQLLTITVK |
| Ga0307474_102210092 | 3300031718 | Hardwood Forest Soil | LPISIMNVMDGMRGNQEMIVSGESNVDETATAALDYVVSGAQLLTVTVK |
| Ga0307475_107005871 | 3300031754 | Hardwood Forest Soil | DGMRGNQEMIVSAESNVDETATPSLDYVVSGAQLLTVTIK |
| Ga0307478_100654171 | 3300031823 | Hardwood Forest Soil | TQDMVVLGESSVSEASTDPLDYVVSGAQMLTIGIK |
| Ga0306926_118992162 | 3300031954 | Soil | ISVMNIMDGMRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK |
| Ga0335078_101536273 | 3300032805 | Soil | RGTQEMVVSNESSVNEAATGPLDYVVSGAQVLTIAIK |
| Ga0335074_103155592 | 3300032895 | Soil | NQEMIVSGESNVDETATPPLDYVVSGAELLTVTVK |
| Ga0335084_100064211 | 3300033004 | Soil | SIMNVMDGMRGNQEMIVSGESNVDETATPSLDYVVSGAQLLTVTVK |
| ⦗Top⦘ |