| Basic Information | |
|---|---|
| Family ID | F105967 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.00 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 0.00% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF03054 | tRNA_Me_trans | 57.00 |
| PF00266 | Aminotran_5 | 5.00 |
| PF02274 | ADI | 4.00 |
| PF03743 | TrbI | 3.00 |
| PF08281 | Sigma70_r4_2 | 2.00 |
| PF00795 | CN_hydrolase | 1.00 |
| PF00285 | Citrate_synt | 1.00 |
| PF05239 | PRC | 1.00 |
| PF07676 | PD40 | 1.00 |
| PF13592 | HTH_33 | 1.00 |
| PF12732 | YtxH | 1.00 |
| PF00561 | Abhydrolase_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 57.00 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 4.00 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 4.00 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 4.00 |
| COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 3.00 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.00 % |
| All Organisms | root | All Organisms | 39.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10165574 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300001545|JGI12630J15595_10100376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 570 | Open in IMG/M |
| 3300003324|soilH2_10401653 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300004152|Ga0062386_101385249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
| 3300005174|Ga0066680_10479505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 783 | Open in IMG/M |
| 3300005338|Ga0068868_100549961 | Not Available | 1017 | Open in IMG/M |
| 3300005437|Ga0070710_10363719 | Not Available | 961 | Open in IMG/M |
| 3300005439|Ga0070711_101547748 | Not Available | 579 | Open in IMG/M |
| 3300005529|Ga0070741_10089594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3325 | Open in IMG/M |
| 3300005536|Ga0070697_101553877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 592 | Open in IMG/M |
| 3300005610|Ga0070763_10638430 | Not Available | 620 | Open in IMG/M |
| 3300005834|Ga0068851_10770337 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005841|Ga0068863_101975909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 593 | Open in IMG/M |
| 3300006102|Ga0075015_100660899 | Not Available | 617 | Open in IMG/M |
| 3300006163|Ga0070715_10614494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 639 | Open in IMG/M |
| 3300006173|Ga0070716_100026540 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
| 3300006173|Ga0070716_101158647 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006176|Ga0070765_101167779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 727 | Open in IMG/M |
| 3300006354|Ga0075021_10080372 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300006796|Ga0066665_11040299 | Not Available | 626 | Open in IMG/M |
| 3300006854|Ga0075425_102579594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 562 | Open in IMG/M |
| 3300006904|Ga0075424_102071777 | Not Available | 600 | Open in IMG/M |
| 3300007076|Ga0075435_101046598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 713 | Open in IMG/M |
| 3300007265|Ga0099794_10246263 | Not Available | 921 | Open in IMG/M |
| 3300009088|Ga0099830_10123160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1965 | Open in IMG/M |
| 3300009093|Ga0105240_12782171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300009174|Ga0105241_11729394 | Not Available | 608 | Open in IMG/M |
| 3300009553|Ga0105249_11868397 | Not Available | 673 | Open in IMG/M |
| 3300010376|Ga0126381_101279433 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300011120|Ga0150983_10367213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300011411|Ga0153933_1089239 | Not Available | 652 | Open in IMG/M |
| 3300012189|Ga0137388_11429231 | Not Available | 630 | Open in IMG/M |
| 3300012202|Ga0137363_10143731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1867 | Open in IMG/M |
| 3300012203|Ga0137399_11023369 | Not Available | 695 | Open in IMG/M |
| 3300012209|Ga0137379_10318612 | Not Available | 1466 | Open in IMG/M |
| 3300012359|Ga0137385_11083488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300012361|Ga0137360_11000876 | Not Available | 721 | Open in IMG/M |
| 3300012363|Ga0137390_11012006 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012922|Ga0137394_10355714 | Not Available | 1250 | Open in IMG/M |
| 3300012948|Ga0126375_11723042 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012957|Ga0164303_10105645 | Not Available | 1405 | Open in IMG/M |
| 3300012958|Ga0164299_10764692 | Not Available | 684 | Open in IMG/M |
| 3300012960|Ga0164301_10340778 | Not Available | 1026 | Open in IMG/M |
| 3300012988|Ga0164306_10903961 | Not Available | 720 | Open in IMG/M |
| 3300013307|Ga0157372_10184556 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
| 3300014200|Ga0181526_10040390 | Not Available | 2991 | Open in IMG/M |
| 3300015193|Ga0167668_1090904 | Not Available | 577 | Open in IMG/M |
| 3300017948|Ga0187847_10352407 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300017955|Ga0187817_10266530 | Not Available | 1091 | Open in IMG/M |
| 3300017955|Ga0187817_10269430 | Not Available | 1085 | Open in IMG/M |
| 3300017955|Ga0187817_10330759 | Not Available | 971 | Open in IMG/M |
| 3300018006|Ga0187804_10273903 | Not Available | 732 | Open in IMG/M |
| 3300018012|Ga0187810_10403799 | Not Available | 575 | Open in IMG/M |
| 3300018057|Ga0187858_10458568 | Not Available | 784 | Open in IMG/M |
| 3300020004|Ga0193755_1081005 | Not Available | 1041 | Open in IMG/M |
| 3300020018|Ga0193721_1106551 | Not Available | 714 | Open in IMG/M |
| 3300020021|Ga0193726_1257248 | Not Available | 703 | Open in IMG/M |
| 3300020580|Ga0210403_11162328 | Not Available | 596 | Open in IMG/M |
| 3300021170|Ga0210400_10392788 | Not Available | 1144 | Open in IMG/M |
| 3300021171|Ga0210405_10078123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2608 | Open in IMG/M |
| 3300021344|Ga0193719_10003137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6679 | Open in IMG/M |
| 3300021406|Ga0210386_11628628 | Not Available | 535 | Open in IMG/M |
| 3300021433|Ga0210391_10241076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
| 3300021861|Ga0213853_11488947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300022467|Ga0224712_10157532 | Not Available | 1011 | Open in IMG/M |
| 3300022756|Ga0222622_11403354 | Not Available | 514 | Open in IMG/M |
| 3300024246|Ga0247680_1035404 | Not Available | 722 | Open in IMG/M |
| 3300025321|Ga0207656_10195210 | Not Available | 976 | Open in IMG/M |
| 3300025321|Ga0207656_10338562 | Not Available | 749 | Open in IMG/M |
| 3300025898|Ga0207692_10240181 | Not Available | 1082 | Open in IMG/M |
| 3300025912|Ga0207707_11184231 | Not Available | 619 | Open in IMG/M |
| 3300025935|Ga0207709_10535413 | Not Available | 919 | Open in IMG/M |
| 3300025961|Ga0207712_11592446 | Not Available | 585 | Open in IMG/M |
| 3300025972|Ga0207668_10087180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2282 | Open in IMG/M |
| 3300026023|Ga0207677_10442422 | Not Available | 1112 | Open in IMG/M |
| 3300026089|Ga0207648_10702023 | Not Available | 937 | Open in IMG/M |
| 3300026291|Ga0209890_10212779 | Not Available | 615 | Open in IMG/M |
| 3300026296|Ga0209235_1147640 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300027565|Ga0209219_1030213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300027567|Ga0209115_1109231 | Not Available | 627 | Open in IMG/M |
| 3300027590|Ga0209116_1110089 | Not Available | 605 | Open in IMG/M |
| 3300027667|Ga0209009_1093586 | Not Available | 762 | Open in IMG/M |
| 3300027867|Ga0209167_10541706 | Not Available | 637 | Open in IMG/M |
| 3300027889|Ga0209380_10004606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8433 | Open in IMG/M |
| 3300027903|Ga0209488_11166453 | Not Available | 521 | Open in IMG/M |
| 3300027905|Ga0209415_10152526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2318 | Open in IMG/M |
| 3300027910|Ga0209583_10506303 | Not Available | 598 | Open in IMG/M |
| 3300028380|Ga0268265_10338369 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300028381|Ga0268264_11124419 | Not Available | 794 | Open in IMG/M |
| 3300030878|Ga0265770_1146426 | Not Available | 515 | Open in IMG/M |
| 3300031240|Ga0265320_10291569 | Not Available | 722 | Open in IMG/M |
| 3300031708|Ga0310686_114520610 | Not Available | 548 | Open in IMG/M |
| 3300031720|Ga0307469_11908895 | Not Available | 575 | Open in IMG/M |
| 3300031823|Ga0307478_10721260 | Not Available | 835 | Open in IMG/M |
| 3300031823|Ga0307478_11772271 | Not Available | 508 | Open in IMG/M |
| 3300031902|Ga0302322_100377489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1620 | Open in IMG/M |
| 3300032205|Ga0307472_102058072 | Not Available | 573 | Open in IMG/M |
| 3300032783|Ga0335079_10048787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4851 | Open in IMG/M |
| 3300032783|Ga0335079_10056992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4460 | Open in IMG/M |
| 3300032783|Ga0335079_11115856 | Not Available | 798 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101655741 | 3300001356 | Peatlands Soil | DMVHNTVVSPVRQLSGIVQGLTVGLEYLMGSRRRRRDRSTVPQDEMFI* |
| JGI12630J15595_101003761 | 3300001545 | Forest Soil | TTEVVHRTVVSPVRHLSGLIQGVTAGVEFLLGGKRRTRDVTVPQDEMFI* |
| soilH2_104016532 | 3300003324 | Sugarcane Root And Bulk Soil | VVSPVRQLSGLIHGVTAALEFLRHGKNGRREGVSVPQDEMFI* |
| Ga0062386_1013852491 | 3300004152 | Bog Forest Soil | IEETSDAVHRTVISPVRQLSGVIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0066680_104795051 | 3300005174 | Soil | VEEATDMVHNTVVSPVRQLSGLLHGLSVGVEFLFGGKRRRREGVTVPQDEMFI* |
| Ga0068868_1005499612 | 3300005338 | Miscanthus Rhizosphere | RTVISPVRQLSGLVQGLTAGLEFLMGTKRRRHDVSVPQDEMFI* |
| Ga0070710_103637192 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVHRTVVSPVRHLSGLIQGVTVGLESLFGGKRAPRRDVTVPQDEMFI* |
| Ga0070711_1015477481 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ETSDVVHRTVISPVRQLSGLVQGLTAGLEFLMGGKRRRHDVSVPQDEMFI* |
| Ga0070741_100895944 | 3300005529 | Surface Soil | VEETTDIVHRTVTSPVRKLSGVFQGVSAGVEYFLGAKRRNRQGVSVPQDEMFI* |
| Ga0070697_1015538771 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DIVHRTVVSPVRQLSGLMKGVSTGLEFFLSNKRRRRGASVPQDEMFI* |
| Ga0070763_106384301 | 3300005610 | Soil | RQLSGLVQGITSGLDFLFGGRRKRNGVPVPQDEMFI* |
| Ga0068851_107703371 | 3300005834 | Corn Rhizosphere | RVEDATEAVHKTVVSPVRQLSGLLHGVTAALEFLRHGKNGKREGVSVPQDEMFI* |
| Ga0068863_1019759091 | 3300005841 | Switchgrass Rhizosphere | RTMDRIEETSDVVHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0075015_1006608992 | 3300006102 | Watersheds | IEDTSEIVHRTVVSPVRQLSGLIQGLTVGLEFLLGGKRRSRQDVTVPQDEMFI* |
| Ga0070715_106144942 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ELLNRTMDRIEETSDAVHRTVISPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0070716_1000265401 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HRTVVSPVRHLSGLIQGVTVGLESLFGGKRAPRRDVTVPQDEMFI* |
| Ga0070716_1011586472 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SPVRQLSGLLNGVTAALEFLRQGKNGKREGVSVPQDEMFI* |
| Ga0070765_1011677792 | 3300006176 | Soil | TSDAVHRTVISPVRQLSGVIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0075021_100803723 | 3300006354 | Watersheds | ELLNRSLDRVETTTDLLHKTVLSPVRQLSGLVQGITTGLEFLIGAKRRQHNGVPAPQDEMFI* |
| Ga0066665_110402992 | 3300006796 | Soil | ETTDMVHRTVVSPVRQLSGLMKGVSTGLEFFLSSKRRRRAASVPQDEMFI* |
| Ga0075425_1025795941 | 3300006854 | Populus Rhizosphere | EETTDVVHRTVVSPVRQLSGLIQGLTAGVEFLFGGKRASRRDATVPQDEMFI* |
| Ga0075424_1020717771 | 3300006904 | Populus Rhizosphere | RQLSGLIQGLTAGVEFLFGGKRASRRDATVPQDEMFI* |
| Ga0075435_1010465982 | 3300007076 | Populus Rhizosphere | RIEETSDVVHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0099794_102462631 | 3300007265 | Vadose Zone Soil | RIEETSDAVHRTVISPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0099830_101231603 | 3300009088 | Vadose Zone Soil | LNRTMDRIEETTDVVHRTVVSPIRQLSGLIQGVTAGLEFLFGGKRASRRDVTVPQDEMFI |
| Ga0105240_127821711 | 3300009093 | Corn Rhizosphere | LSGLLHGVTAALEFLRHGKNGKREGVSVPQDEMFI* |
| Ga0105241_117293941 | 3300009174 | Corn Rhizosphere | DELLNRTMDRIEETSDVVHRTVISPVRQLSGLVQGLTAGLEFLMGTKRRRHDVSVPQDEMFI* |
| Ga0105249_118683971 | 3300009553 | Switchgrass Rhizosphere | ISPVRQLSGLVQGLTAGLEFLMGTKRRRHDVSVPQDEMFI* |
| Ga0126381_1012794332 | 3300010376 | Tropical Forest Soil | VRQLAGVVQGFGAGLEFLLGSKRRRRSESTVPQDEMFI* |
| Ga0150983_103672132 | 3300011120 | Forest Soil | RVESTTDMVHKTVLSPVRQLSGLVQGITTGLEFLMGARRRQRNGVPAPQDEMFI* |
| Ga0153933_10892392 | 3300011411 | Attine Ant Fungus Gardens | VRQLAGLVQGITSGVEFFIGAKRRRRNGAGMPQDEMFI* |
| Ga0137388_114292312 | 3300012189 | Vadose Zone Soil | NGLVSGVTAGLEFLMGGKKRRRDGVSVPQDEMFI* |
| Ga0137363_101437311 | 3300012202 | Vadose Zone Soil | NRTMDRIEDTSDVVHRTVISPVRQLSGLIQGLTVGLEFLLGGKRRSRQDVTVPQDEMFI* |
| Ga0137399_110233692 | 3300012203 | Vadose Zone Soil | SPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0137379_103186121 | 3300012209 | Vadose Zone Soil | PIRQLAGVVQGLSAGVDYFLGAKRRRRNNGVAAPQDEMFI* |
| Ga0137385_110834881 | 3300012359 | Vadose Zone Soil | RKISGIFHGVTAGLEFLVGGKRRQRNGVSVPQDEMFI* |
| Ga0137360_110008762 | 3300012361 | Vadose Zone Soil | TTDVVHRTVVSPVRQLSGLIQGVSAGLEFLFGGKRDSRRDVTVPQDEMFI* |
| Ga0137390_110120061 | 3300012363 | Vadose Zone Soil | QATDIVHETLVSPVRQLSGLLQGLTVGLEFLLGGKRRRREGVTVPQDEMFI* |
| Ga0137394_103557141 | 3300012922 | Vadose Zone Soil | VHRTVISPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0126375_117230421 | 3300012948 | Tropical Forest Soil | DATEVVHKTVVSPVRQVSGLMHGITAALEFLRNGKRRDGATVPQDEMFI* |
| Ga0164303_101056452 | 3300012957 | Soil | VHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0164299_107646922 | 3300012958 | Soil | PIRKISGLFQGLTAGLEFLMGSKRRGERVTVPQDEMFI* |
| Ga0164301_103407781 | 3300012960 | Soil | ISPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0164306_109039611 | 3300012988 | Soil | VHRTVISPVRQLSGLVQGLTAGLEFLMGTKRRRHDVSVPQDEMFI* |
| Ga0157372_101845564 | 3300013307 | Corn Rhizosphere | VHKTVVSPVRQLSGLLHGVTAALEFLRHGKNGKREGVSVPQDEMFI* |
| Ga0181526_100403901 | 3300014200 | Bog | PVRQLSGLVQGITSGVEFLIGSKRRQRNGVPVPQDEMFI* |
| Ga0167668_10909041 | 3300015193 | Glacier Forefield Soil | TMDRIEETSDAVHRTVISPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI* |
| Ga0187847_103524072 | 3300017948 | Peatland | DLVHKTVVSPVRQLSGLVQGITSGVEFLIGSKRRQRNGVPVPQDEMFI |
| Ga0187817_102665301 | 3300017955 | Freshwater Sediment | IVEKTVVSPVRQLAGIVQGVTTGLEFLFGGRRRSRNGITVPQDEMFI |
| Ga0187817_102694301 | 3300017955 | Freshwater Sediment | STTDLVHKTVVSPVRQLAGLVQGVTSGLEFLIGSKRRRHNGVGVPQDEMFI |
| Ga0187817_103307592 | 3300017955 | Freshwater Sediment | SPVRQLAGLVQGITSGLEFLIGAKRRRRDGVPVPQDEMFI |
| Ga0187804_102739031 | 3300018006 | Freshwater Sediment | PVRQLAGLVQGITSGLEFLIGAKRRRRDGVPVPQDEMFI |
| Ga0187810_104037992 | 3300018012 | Freshwater Sediment | QTTELVQKTVVSPVRQFSGLVRGVTAGLEFLLGARRRHRDGVTVPQDEMFI |
| Ga0187858_104585683 | 3300018057 | Peatland | VVSPVRQLSGLVQGITSGVEFLIGSKRRQRNGVPVPQDEMFI |
| Ga0193755_10810051 | 3300020004 | Soil | ETSDAVHRTVISPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0193721_11065511 | 3300020018 | Soil | TMDRIEETTDVVHRTVVSPVRQLSGLIQGLTAGLEFLFGGRRASRRDVTVPQDEMFI |
| Ga0193726_12572482 | 3300020021 | Soil | QVSGLIQGVTAGLEFLVGSKRRQRDEVVPQDEMFI |
| Ga0210403_111623281 | 3300020580 | Soil | PVRQLSGLVQGITTGLEFLMGAKRRQRNGVPVPQDEMFI |
| Ga0210400_103927881 | 3300021170 | Soil | VISPVRQLSGFIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0210405_100781231 | 3300021171 | Soil | KTVVSPVRQVAGLMQGITSGVEFFLGAKRRRRNGVGVPQDEMFI |
| Ga0193719_100031371 | 3300021344 | Soil | ELLKRTMDRIEETTDVVHRTVVSPVRQLSGLIQGLTAGLEFLFGGRRASRRDVTVPQDEMFI |
| Ga0210386_116286282 | 3300021406 | Soil | SDAVHRTVISPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0210391_102410763 | 3300021433 | Soil | LSGLVQGITSGVEFLIGSKRRQRNGVPVPQDEMFI |
| Ga0213853_114889471 | 3300021861 | Watersheds | TSEMVHKTVVSPVRQLSGLVQGVTAGLEFLIGAKRGRNGGGSPHDEMFI |
| Ga0224712_101575321 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | HRTVVSPVRQISALMQGLSVGFGSLFGAKRTRRNGSPVPQDEMFI |
| Ga0222622_114033541 | 3300022756 | Groundwater Sediment | RTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0247680_10354042 | 3300024246 | Soil | TVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0207656_101952101 | 3300025321 | Corn Rhizosphere | DVVHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0207656_103385621 | 3300025321 | Corn Rhizosphere | RKISGLFQGLTAGLEFLMGSKRRGERVTVPQDEMFI |
| Ga0207692_102401812 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVHRTVVSPVRHLSGLIQGVTVGLESLFGGKRAPRRDVTVPQDEMFI |
| Ga0207707_111842311 | 3300025912 | Corn Rhizosphere | EETSDVVHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0207709_105354131 | 3300025935 | Miscanthus Rhizosphere | GAMDRIEETSDVVHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0207712_115924462 | 3300025961 | Switchgrass Rhizosphere | MDRIEETSDVVHRTVISPVRQLSGLVQGLTAGLEFLMGTKRRRHDVSVPQDEMFI |
| Ga0207668_100871801 | 3300025972 | Switchgrass Rhizosphere | SPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0207677_104424222 | 3300026023 | Miscanthus Rhizosphere | QLSGLVQGLTAGLEFLMGTKRRRHDVSVPQDEMFI |
| Ga0207648_107020232 | 3300026089 | Miscanthus Rhizosphere | ELLNRTMDRIEETSDVVHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0209890_102127792 | 3300026291 | Soil | DVVHQSIVSPVRKLAGVIQGLTAALEYFVGTRRRRRDRSSVPQDEMFI |
| Ga0209235_11476401 | 3300026296 | Grasslands Soil | TDMVHDTVVSPVRRFSAVLQGVTAGLEFLLGGKRRRREGVTVPQDEMFI |
| Ga0209219_10302131 | 3300027565 | Forest Soil | ADELLNRTMDRIEETSDAVHRTVISPVRQLSGVIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0209115_11092312 | 3300027567 | Forest Soil | SPVRQLSGLVQGITSGVEFLIGAKRRQRNGVPVPQDEMFI |
| Ga0209116_11100892 | 3300027590 | Forest Soil | LVHKTVVSPVRQLSGLVQGITSGVEFLIGAKRRQRNGVPVPQDEMFI |
| Ga0209009_10935862 | 3300027667 | Forest Soil | LNRTMDRIEDTSEAVHKTVVSPVRQLSGLIQGLTAGLESLFGEKRSSRRDVTVPQDEMFI |
| Ga0209167_105417061 | 3300027867 | Surface Soil | RVESTTDMVHKTVVSPVRQLSGLVQGITSGLEFLMGGRRKRNGVAVPQDEMFI |
| Ga0209380_100046063 | 3300027889 | Soil | MVHKTVVSPVRQLSGLVQGITSGLDFLFGGRRKRNGVPVPQDEMFI |
| Ga0209488_111664532 | 3300027903 | Vadose Zone Soil | RTVISPVRQLSGIIQGLSAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0209415_101525261 | 3300027905 | Peatlands Soil | LDRVESTTDLVHNTVVSPVRQLAGLIQGITAGVEFLVGSKRRRRNGVTVPQDEMFI |
| Ga0209583_105063031 | 3300027910 | Watersheds | RIEDTTDVVHRTVVSPVRQLAGLIQGVTVGLDFLFGGKRRHRGDVTVPQDEMFI |
| Ga0268265_103383693 | 3300028380 | Switchgrass Rhizosphere | RQLSGLLHGVTAALEFLRHGKNGKREGVSVPQDEMFI |
| Ga0268264_111244191 | 3300028381 | Switchgrass Rhizosphere | DELLNRTMDRIEETSDVVHRTVVSPVRQLSGIIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0265770_11464262 | 3300030878 | Soil | PVRQLSGLVQGITSGLDFLFAGRRKRNGVPVPQDEMFI |
| Ga0265320_102915691 | 3300031240 | Rhizosphere | RTVISPVRQLSGVIQGLTAGLEFLLGGERRRRHDVSVPQDEMFI |
| Ga0310686_1145206101 | 3300031708 | Soil | HKTVVSPVRQLSGLVQGITSGLDFLFGGRRKRNGVPVPQDEMFI |
| Ga0307469_119088952 | 3300031720 | Hardwood Forest Soil | ADELLNRTMDRIEETSDVVHRTVVSPIRQLSGLVQGLTAGLDFLLGGKRHRGNDVSVPQDEMFI |
| Ga0307478_107212601 | 3300031823 | Hardwood Forest Soil | PVRQLSGLVQGITSGLEFLIGAKRRRRNGVPVPQDEMFI |
| Ga0307478_117722711 | 3300031823 | Hardwood Forest Soil | ESTTNLVHRTVVSPVRQLSGLVQGITSGLEFLIGAKRRGRNGVPVPQDEMFI |
| Ga0302322_1003774893 | 3300031902 | Fen | TLDKVEATTDMVQRTVVSPVRQISGIFHGVTAGLEFLVGGKRRPRNGASVPQDEMFI |
| Ga0307472_1020580721 | 3300032205 | Hardwood Forest Soil | IEETTDVVHRTVVSPVRQLSGLVQGLTAGLEFLFGGKRPSRRDVTVPQDEMFI |
| Ga0335079_100487871 | 3300032783 | Soil | VVHKTVISPVRQLAGLVQGVTTAVEFLVGSRRHRRNGANVSQDEMFI |
| Ga0335079_100569925 | 3300032783 | Soil | EIVHHSVISPVRQFAGILRGVTVGLEFLMGSRRRRDGVHVPQDEMFI |
| Ga0335079_111158562 | 3300032783 | Soil | RVEETTDFVHKTVVSPVRQVSGLIQGLTAGVEFFLSGRRRRRDGVPAAQDEMFI |
| ⦗Top⦘ |