| Basic Information | |
|---|---|
| Family ID | F105947 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VAKPAKKTEKSPKSGEQIVAQNRAASYNYHILEKHEA |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 0.00% Coil/Unstructured: 61.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01668 | SmpB | 23.00 |
| PF13181 | TPR_8 | 11.00 |
| PF00263 | Secretin | 7.00 |
| PF07719 | TPR_2 | 7.00 |
| PF00515 | TPR_1 | 5.00 |
| PF13432 | TPR_16 | 4.00 |
| PF14559 | TPR_19 | 2.00 |
| PF13633 | Obsolete Pfam Family | 1.00 |
| PF13544 | Obsolete Pfam Family | 1.00 |
| PF07963 | N_methyl | 1.00 |
| PF06552 | TOM20_plant | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 23.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.00 % |
| Unclassified | root | N/A | 20.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10554823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300004091|Ga0062387_100921826 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005180|Ga0066685_11030432 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005183|Ga0068993_10156359 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005446|Ga0066686_10923048 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005559|Ga0066700_10292551 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005561|Ga0066699_10603750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300005568|Ga0066703_10563334 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005574|Ga0066694_10519494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
| 3300006041|Ga0075023_100316788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300006047|Ga0075024_100544455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 615 | Open in IMG/M |
| 3300006050|Ga0075028_100374830 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300006052|Ga0075029_100962778 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300006052|Ga0075029_101191156 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006059|Ga0075017_101537618 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006163|Ga0070715_10944620 | Not Available | 534 | Open in IMG/M |
| 3300006800|Ga0066660_11026005 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300007076|Ga0075435_100255526 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300007788|Ga0099795_10324845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300009038|Ga0099829_10214099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1563 | Open in IMG/M |
| 3300009038|Ga0099829_11463397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300009143|Ga0099792_10443590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300009143|Ga0099792_10631488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300009522|Ga0116218_1268297 | Not Available | 766 | Open in IMG/M |
| 3300009617|Ga0116123_1016624 | Not Available | 2431 | Open in IMG/M |
| 3300009621|Ga0116116_1067739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300010043|Ga0126380_10694114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300010359|Ga0126376_10537722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1091 | Open in IMG/M |
| 3300011269|Ga0137392_10864949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300011270|Ga0137391_10438382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
| 3300011271|Ga0137393_10028597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4189 | Open in IMG/M |
| 3300012096|Ga0137389_10650038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300012189|Ga0137388_10071154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2898 | Open in IMG/M |
| 3300012200|Ga0137382_10254541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
| 3300012202|Ga0137363_10055615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2855 | Open in IMG/M |
| 3300012203|Ga0137399_10140974 | Not Available | 1915 | Open in IMG/M |
| 3300012361|Ga0137360_10779935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300012361|Ga0137360_11671725 | Not Available | 542 | Open in IMG/M |
| 3300012362|Ga0137361_10072253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2927 | Open in IMG/M |
| 3300012363|Ga0137390_10539289 | Not Available | 1138 | Open in IMG/M |
| 3300012582|Ga0137358_10466814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300012683|Ga0137398_11150182 | Not Available | 532 | Open in IMG/M |
| 3300012918|Ga0137396_11100880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300012918|Ga0137396_11296586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012922|Ga0137394_10524347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300012927|Ga0137416_10577423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300012948|Ga0126375_11710417 | Not Available | 546 | Open in IMG/M |
| 3300014150|Ga0134081_10109893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300015052|Ga0137411_1089185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1734 | Open in IMG/M |
| 3300016270|Ga0182036_11567115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300016357|Ga0182032_10122226 | Not Available | 1880 | Open in IMG/M |
| 3300016422|Ga0182039_10124739 | Not Available | 1949 | Open in IMG/M |
| 3300017955|Ga0187817_10040764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2840 | Open in IMG/M |
| 3300017959|Ga0187779_10140904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1480 | Open in IMG/M |
| 3300017993|Ga0187823_10183940 | Not Available | 677 | Open in IMG/M |
| 3300017994|Ga0187822_10128004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300018018|Ga0187886_1089770 | Not Available | 1303 | Open in IMG/M |
| 3300020140|Ga0179590_1108203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300020580|Ga0210403_10463557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300021086|Ga0179596_10563779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300021406|Ga0210386_11666599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300021474|Ga0210390_10135168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2073 | Open in IMG/M |
| 3300021478|Ga0210402_11463380 | Not Available | 610 | Open in IMG/M |
| 3300021479|Ga0210410_11302217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300021559|Ga0210409_10623585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300024251|Ga0247679_1062291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300024271|Ga0224564_1080510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300026023|Ga0207677_12015117 | Not Available | 537 | Open in IMG/M |
| 3300026304|Ga0209240_1261219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300026309|Ga0209055_1227826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300026536|Ga0209058_1327321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300026887|Ga0207805_1022138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300027003|Ga0207722_1014461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300027174|Ga0207948_1026073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300027651|Ga0209217_1050327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300027701|Ga0209447_10008410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3020 | Open in IMG/M |
| 3300027701|Ga0209447_10214081 | Not Available | 526 | Open in IMG/M |
| 3300027767|Ga0209655_10138127 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300027829|Ga0209773_10182720 | Not Available | 876 | Open in IMG/M |
| 3300027875|Ga0209283_10724567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300027889|Ga0209380_10843132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300028047|Ga0209526_10288969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
| 3300028047|Ga0209526_10623725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300028536|Ga0137415_10633509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300029636|Ga0222749_10010777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3681 | Open in IMG/M |
| 3300030848|Ga0075388_11312865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300031057|Ga0170834_105598396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300031474|Ga0170818_107936533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300031720|Ga0307469_12315943 | Not Available | 524 | Open in IMG/M |
| 3300031910|Ga0306923_11330444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300031945|Ga0310913_11049006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031954|Ga0306926_10719657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300032025|Ga0318507_10468960 | Not Available | 548 | Open in IMG/M |
| 3300032035|Ga0310911_10848392 | Not Available | 527 | Open in IMG/M |
| 3300032205|Ga0307472_100328813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300032782|Ga0335082_10449763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1151 | Open in IMG/M |
| 3300032892|Ga0335081_11121669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300032897|Ga0335071_10396543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1333 | Open in IMG/M |
| 3300033004|Ga0335084_11830279 | Not Available | 594 | Open in IMG/M |
| 3300033158|Ga0335077_10444807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1382 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105548231 | 3300001593 | Forest Soil | VAKPAKKSAKTDKVEELIVAQNRAASYNYHILDKF |
| Ga0062387_1009218261 | 3300004091 | Bog Forest Soil | MKPMKKPGKGKDDKQQGELIVAQNRAASYNYHILEKMEAGLV |
| Ga0066685_110304321 | 3300005180 | Soil | VAKPAKNTEKSEKSAKSGEQIVAQNRAASYNYHILEKHEAG |
| Ga0068993_101563592 | 3300005183 | Natural And Restored Wetlands | VSKLAKPSKKTGKKEGSGELIVAQNRAASYNYHLLEKMEAGMVL |
| Ga0066686_109230482 | 3300005446 | Soil | VAKPAKKTEKSAKSGEQIVAQNRAASYNYHILEKHEAGLV |
| Ga0066700_102925511 | 3300005559 | Soil | VAKPAKKTEKSPKSGEQIVAQNRAASYNYHILEKHEA |
| Ga0066699_106037502 | 3300005561 | Soil | VAKPAKKSAKDAKPGELIVAQNRAASYNYHILEKH |
| Ga0066703_105633342 | 3300005568 | Soil | VPKQPKKTEKAEKNKEQVVAQNRSASYNYHLLEKYE |
| Ga0066694_105194941 | 3300005574 | Soil | VAKHAKASEKPKEQIVAQNRAAGYNYHLLERLEAGLIL |
| Ga0075023_1003167882 | 3300006041 | Watersheds | VAKPAKKTEKSAKSGEQIVAQNRAASYNYHILEKHE |
| Ga0075024_1005444551 | 3300006047 | Watersheds | VPKPPKKTEKAEKSKEQIVAQNRSASYNYHLLERYEAGLV |
| Ga0075028_1003748301 | 3300006050 | Watersheds | VAKAPKKQEKTAELVVAQNRAASYNYHLLEKLEAGMVLL |
| Ga0075029_1009627782 | 3300006052 | Watersheds | VPKPTKKPEKGTKSGEQIVAQNRAASYNYHLLDRMEAGLVLH |
| Ga0075029_1011911561 | 3300006052 | Watersheds | VPKPPKKTEKTEKSKEQIVAQNRSASYNYHLLERYEA |
| Ga0075017_1015376181 | 3300006059 | Watersheds | VAKPPKNQKKTEELVVAQNRAASYNYHLLEKLEAG |
| Ga0070715_109446202 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VVKPNNKTERAKDGKRPKEQIVAQNRSASYNYHIL |
| Ga0066660_110260052 | 3300006800 | Soil | VAKHAKASEKTKEQIVAQNRAAGYNYHLLERLEAG |
| Ga0075435_1002555262 | 3300007076 | Populus Rhizosphere | VAKPAKKTPKGAKPGELIVAQNRAASYNYHILEKHEAGL |
| Ga0099795_103248451 | 3300007788 | Vadose Zone Soil | VPKPPKKTEKAEKSSKEQVVAQNRSASYNYHLLEKYE |
| Ga0099829_102140992 | 3300009038 | Vadose Zone Soil | VAKPAKKTEKSAKPGEQIVAQNRAAAYNYHILEKHE |
| Ga0099829_114633971 | 3300009038 | Vadose Zone Soil | VAKPAKSTEKSAKSGEQIVAQNRAASYNYHILEKHEAG |
| Ga0099792_104435901 | 3300009143 | Vadose Zone Soil | VPRPPKKSEKSGKSDQPKEQIVAQNRSASYNYHLLERFEAGM |
| Ga0099792_106314882 | 3300009143 | Vadose Zone Soil | VPKPPKKTEKAEKSKEEVVAQNRAASYNYHLLEKYEA |
| Ga0116218_12682972 | 3300009522 | Peatlands Soil | VAKPPKKQEKLAELVVAQNRAASYRYHLLEKLEAGM |
| Ga0116123_10166242 | 3300009617 | Peatland | VTKPTKKPEKGKDTKGPRDLIVAQNRSASYHYHILEK |
| Ga0116116_10677391 | 3300009621 | Peatland | VAKPTKKPEKGKDTRGPRELIVAQNRAASYHYHILEKLEA |
| Ga0126380_106941142 | 3300010043 | Tropical Forest Soil | VAKSAKKSEKSSKPAEQIVAQNRAASHNYHILERHE |
| Ga0126376_105377222 | 3300010359 | Tropical Forest Soil | VGKPPKKSDKGAKPAEQIVAQNRAASYNYHILERHEAGLV |
| Ga0137392_108649491 | 3300011269 | Vadose Zone Soil | VAKPAKKTEKSAKPGEQIVAQNRAASYNYHILEKHEAGLV |
| Ga0137391_104383821 | 3300011270 | Vadose Zone Soil | VAKPAKKTERSPKSGEQIVAQNRAASYNYHILEKHE |
| Ga0137393_100285976 | 3300011271 | Vadose Zone Soil | VAKPAKKTDRSARSGEQIVAQNRSASYNYHILEKHEAGL |
| Ga0137389_106500382 | 3300012096 | Vadose Zone Soil | VAKPVKKTEKSAKSGEQIVAQNRAASYNYHILEKH |
| Ga0137388_100711541 | 3300012189 | Vadose Zone Soil | VAKPAKKSEKSAKSGEQIVAQNRSASYNYHILEKHE |
| Ga0137382_102545412 | 3300012200 | Vadose Zone Soil | VAKPAKKTKKFAKSGEQIVAQNRAASYNYLIVEKHEA |
| Ga0137363_100556151 | 3300012202 | Vadose Zone Soil | VPKPPKKTEKAEKSKEQIVAQNRAASYNYHLLERY |
| Ga0137399_101409742 | 3300012203 | Vadose Zone Soil | VAKPAKNTEKSAKSGEQIVAQNRAASYNYHILEKHEAGLVL |
| Ga0137360_107799352 | 3300012361 | Vadose Zone Soil | VAKPAKNTEKSEKSAKSGEQIVAQNRAASYNYHILEK |
| Ga0137360_116717252 | 3300012361 | Vadose Zone Soil | VPKPTKKTEKAEKSKEEVVAQNRAASYNYHLLERYEA |
| Ga0137361_100722533 | 3300012362 | Vadose Zone Soil | VPKPQKKTEKTEKSKEQIVAQNRSASYNYHLLERYEA |
| Ga0137390_105392891 | 3300012363 | Vadose Zone Soil | VPKPPQKTEKSNKPKEQIVAQNRAASYNYHLLERYEAGL |
| Ga0137358_104668142 | 3300012582 | Vadose Zone Soil | VAKPAKKSEKSAKSGEQIVAQNRSASHNYHILEKH |
| Ga0137398_111501821 | 3300012683 | Vadose Zone Soil | VAKSPKKQEKPAELLVAQNRAASYNYHLLEKHEAGMV |
| Ga0137396_111008801 | 3300012918 | Vadose Zone Soil | VAKPAKKTEKPAKSGEQIVAQNRAASYNYHILEKHEAG |
| Ga0137396_112965861 | 3300012918 | Vadose Zone Soil | VTKPAKNTEKSKKSAKSGEQIVAQNRAASYNYHILEKHEAG |
| Ga0137394_105243471 | 3300012922 | Vadose Zone Soil | VAKPGKKSEKSAKSGEQIVAQNRAASYNYHILEKHEA |
| Ga0137416_105774232 | 3300012927 | Vadose Zone Soil | VAKPAKNTEKSEKSAKSGEQLVAQNRAASYNYHILEKHEAG |
| Ga0126375_117104171 | 3300012948 | Tropical Forest Soil | VTKPTKSAEKPKSKQAKGPREQIVAQNRSASYNYHILEKLEAGL |
| Ga0134081_101098932 | 3300014150 | Grasslands Soil | VAKPAKKSEKSAKSGEQIVAQNRAASYNYHILEKH |
| Ga0137411_10891851 | 3300015052 | Vadose Zone Soil | VAKPAKKTEKSAKSGEQIVKSGEQIVAQNRAASYN |
| Ga0182036_115671152 | 3300016270 | Soil | VAKPAKKSEKAPKAGEQIVAQNRAASYNYHILERHEAGLV |
| Ga0182032_101222262 | 3300016357 | Soil | VAKPNKKTEKGKVAKGPREQIVAQNRSASFHYHILEKLEAGLVL |
| Ga0182039_101247391 | 3300016422 | Soil | VAKPSNKTEKGKVSKGPREQIVAQNRSASFHYHIL |
| Ga0187817_100407643 | 3300017955 | Freshwater Sediment | VAKPTNKPGKSKDAKPLEQIVAQNRAASYHYHILEKLE |
| Ga0187779_101409042 | 3300017959 | Tropical Peatland | VPKPAKKSEKPSQSAKSGEQIVAQNRAASYNYHIL |
| Ga0187823_101839401 | 3300017993 | Freshwater Sediment | VAKPPKNQKKPAELVVAQNRAASYNYHLLERLEAG |
| Ga0187822_101280042 | 3300017994 | Freshwater Sediment | VAKAPKNQKKHAELVVAQNRAASYNYHLLEKLEAG |
| Ga0187886_10897701 | 3300018018 | Peatland | VTKPTKKPEKGKDAKGPRDLIVAQNRAASYHYHILEKLEAGL |
| Ga0179590_11082031 | 3300020140 | Vadose Zone Soil | VPKPPKKTEKAEKSKEEVVAQNRSASYNYHLLEKYE |
| Ga0210403_104635572 | 3300020580 | Soil | VVKPNNKTERAKDGKRPKEQIVAQNRSASYNYHILEKLEAGL |
| Ga0179596_105637792 | 3300021086 | Vadose Zone Soil | VPKPPKKTEKAEKSKEQVVAQNRSASYNYHLLEKYEA |
| Ga0210386_116665991 | 3300021406 | Soil | VPKPAKKPEKDSKAGEQIVAQNRAASFNYHLLDRYEAGL |
| Ga0210390_101351682 | 3300021474 | Soil | VAKPPKKQEKLAELVVAQNRAASYNYHLLEKLEAGM |
| Ga0210402_114633801 | 3300021478 | Soil | VTKPNKKPEKGRDGPRELIVAQNRAASYNYHILEKLEAGL |
| Ga0210410_113022171 | 3300021479 | Soil | VPKPPKKPEKSPEKSKHKEKDQIVAQNRAASYNYHLLERLEA |
| Ga0210409_106235852 | 3300021559 | Soil | VAKPAKKTEKSAKSGEQIVAQNRAASYNYHILEKLE |
| Ga0247679_10622911 | 3300024251 | Soil | VPKPAKKLEKGTKSGEQVVAQNRAASYNFHLLDRFEA |
| Ga0224564_10805102 | 3300024271 | Soil | VPKPAKKPEKDSKAGEQIVAQNRAASYNFHLLDRF |
| Ga0207677_120151171 | 3300026023 | Miscanthus Rhizosphere | VAKSPKTQEKQQAEVLVAQNRAASYNYHLLERLEAGMVL |
| Ga0209240_12612192 | 3300026304 | Grasslands Soil | LKAVAKPAKKLVQSANKAGELVVAQNRAASYNYHLLERME |
| Ga0209055_12278262 | 3300026309 | Soil | VAKPANKTENSAKSGEHIVAQNRSASYNYQILEKHEAGLV |
| Ga0209058_13273212 | 3300026536 | Soil | VAKPRKKSEKAARSGEQIVAQNRAASYNYHILERHEAGM |
| Ga0207805_10221382 | 3300026887 | Tropical Forest Soil | VAKPNTKQGKTKDAKAPRELIVAQNRAASYNYHILEK |
| Ga0207722_10144612 | 3300027003 | Tropical Forest Soil | VAKPNKKTEKGKLAKAAREQIVAQNRSASFHYHILERLE |
| Ga0207948_10260731 | 3300027174 | Forest Soil | VAKPSKKSEKDAKSGEQIVAQNRAASYNYHILEKHEAGLVL |
| Ga0209217_10503272 | 3300027651 | Forest Soil | VAKPPKKQGKPAELLVAQNRAASYNYHLLEKHEAGMV |
| Ga0209447_100084101 | 3300027701 | Bog Forest Soil | VPKPAKKPEKDSKAGEQVVAQNRAASYNFHLLDRFEAGLV |
| Ga0209447_102140811 | 3300027701 | Bog Forest Soil | MVTVPNKRTDRGKDPKKPRELIVAQNRAASYNYHILEKIEAGL |
| Ga0209655_101381271 | 3300027767 | Bog Forest Soil | VPKPPKKPEKSPEKSKHKEKDQIVAQNRAASYNYHLLERL |
| Ga0209773_101827202 | 3300027829 | Bog Forest Soil | VIHPKKKPEKAKDAKAATDKIVAQNRAASYNYHILERMEAGLILH |
| Ga0209283_107245671 | 3300027875 | Vadose Zone Soil | VAKPAKKSEKSAKSGEQIVAQNRSASYNYHILEKH |
| Ga0209380_108431322 | 3300027889 | Soil | VPKPAKKPEKDSKAGEQIVAQNRAASYNFHLLDRFEAGL |
| Ga0209526_102889692 | 3300028047 | Forest Soil | VPKPAKKPEKSKGKEKEQIVAQNRSASYNYHLLEKL |
| Ga0209526_106237252 | 3300028047 | Forest Soil | VAKPPKKSAKTDKVEELIVAQNRAASYNYHILDKF |
| Ga0137415_106335091 | 3300028536 | Vadose Zone Soil | VAKHAKASEKPKEQIVAQNRTAGYNYHLLERLEAG |
| Ga0222749_100107771 | 3300029636 | Soil | VAKPAKKLEKSEKSGEQIVAQNRAASYNYHILERHEAGLV |
| Ga0075388_113128651 | 3300030848 | Soil | VARPAKKPVQSANKAGELVVAQNRAAGYNYHLLERMEAGIVL |
| Ga0170834_1055983961 | 3300031057 | Forest Soil | VAKPPNKQEKSTELVVAQNRAASYNYHLLERLEAGM |
| Ga0170818_1079365331 | 3300031474 | Forest Soil | VAKPAKKPVQSANKAGELVVAQNRAASYNYHLLERMEA |
| Ga0307469_123159431 | 3300031720 | Hardwood Forest Soil | MAVTKPQKKPGKPAEFVAAQNRSAPYNYHLLEKQEAGMVLL |
| Ga0306923_113304441 | 3300031910 | Soil | VAKPNKKTEKGKVAKGPREQIVAQNRSASFHYHIL |
| Ga0310913_110490061 | 3300031945 | Soil | VAKPAKKSEKAPKAGEQIVAQNRAASYNYHILERHEAGLVL |
| Ga0306926_107196572 | 3300031954 | Soil | VAKPSKSTEKGKDPKRPRELIVAQNRAASYNYHILE |
| Ga0318507_104689602 | 3300032025 | Soil | VAKPNKKTEKGKVAKGPREQIVAQNRSASFHYHILEKLEA |
| Ga0310911_108483922 | 3300032035 | Soil | VAKPNKKTEKAKLAKGPREQIVAQNRSASFHYHILEKLEAGL |
| Ga0307472_1003288131 | 3300032205 | Hardwood Forest Soil | VAKPAKKPVQSANKAGELVVAQNRAASYNYHLLERMEAGIV |
| Ga0335082_104497632 | 3300032782 | Soil | VAKPKKSAEKPKEQIVAQNRAAGYNYHLLEKLEAGLVLH |
| Ga0335081_111216692 | 3300032892 | Soil | VAKPTDKPGKSKDTKPREQIVAQNRAASYHYHILEKLEA |
| Ga0335071_103965431 | 3300032897 | Soil | VTKPTKNAEKPKGKQAPKPREQIVAQNRAASYNYHILE |
| Ga0335084_118302791 | 3300033004 | Soil | VAKPPHKPAKGKDTKAAREQIVAQNRAASYNYHILEKLEAG |
| Ga0335077_104448071 | 3300033158 | Soil | VAKANNKSERAKDGKRPKEQIVAQNRSASYNYHILEKL |
| ⦗Top⦘ |