| Basic Information | |
|---|---|
| Family ID | F105918 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAREADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTS |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.00 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (30.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.53% β-sheet: 0.00% Coil/Unstructured: 39.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 90.00 |
| PF13759 | 2OG-FeII_Oxy_5 | 9.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.00 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 13.00 % |
| Unclassified | root | N/A | 11.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10041213 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2409 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10172176 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 762 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10275792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 515 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10177224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 610 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10229007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 578 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10064291 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1517 | Open in IMG/M |
| 3300001450|JGI24006J15134_10196219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 619 | Open in IMG/M |
| 3300001472|JGI24004J15324_10082561 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 866 | Open in IMG/M |
| 3300001472|JGI24004J15324_10095970 | Not Available | 771 | Open in IMG/M |
| 3300001472|JGI24004J15324_10102855 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 730 | Open in IMG/M |
| 3300001472|JGI24004J15324_10115139 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300001472|JGI24004J15324_10125406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 623 | Open in IMG/M |
| 3300001589|JGI24005J15628_10090500 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1052 | Open in IMG/M |
| 3300002482|JGI25127J35165_1029215 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
| 3300002483|JGI25132J35274_1043778 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300002488|JGI25128J35275_1024164 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1467 | Open in IMG/M |
| 3300005086|Ga0072334_10385888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 649 | Open in IMG/M |
| 3300006164|Ga0075441_10063186 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1451 | Open in IMG/M |
| 3300006164|Ga0075441_10291842 | unclassified Hyphomonas → Hyphomonas sp. | 596 | Open in IMG/M |
| 3300006193|Ga0075445_10045912 | All Organisms → Viruses → Predicted Viral | 1753 | Open in IMG/M |
| 3300006752|Ga0098048_1033341 | unclassified Hyphomonas → Hyphomonas sp. | 1670 | Open in IMG/M |
| 3300006752|Ga0098048_1212855 | Not Available | 569 | Open in IMG/M |
| 3300006793|Ga0098055_1244908 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 675 | Open in IMG/M |
| 3300006920|Ga0070748_1188598 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 757 | Open in IMG/M |
| 3300006928|Ga0098041_1241513 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 576 | Open in IMG/M |
| 3300006929|Ga0098036_1081388 | unclassified Hyphomonas → Hyphomonas sp. | 998 | Open in IMG/M |
| 3300006947|Ga0075444_10057797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1809 | Open in IMG/M |
| 3300006990|Ga0098046_1091407 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300007276|Ga0070747_1260914 | unclassified Hyphomonas → Hyphomonas sp. | 600 | Open in IMG/M |
| 3300007276|Ga0070747_1321248 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 530 | Open in IMG/M |
| 3300007539|Ga0099849_1027792 | All Organisms → Viruses → Predicted Viral | 2431 | Open in IMG/M |
| 3300008218|Ga0114904_1020071 | Not Available | 1976 | Open in IMG/M |
| 3300008220|Ga0114910_1071665 | Not Available | 1071 | Open in IMG/M |
| 3300008220|Ga0114910_1071853 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1069 | Open in IMG/M |
| 3300008220|Ga0114910_1116186 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon SCG-AAA382B04 | 785 | Open in IMG/M |
| 3300008220|Ga0114910_1193166 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 563 | Open in IMG/M |
| 3300009418|Ga0114908_1084926 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300009418|Ga0114908_1136842 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 794 | Open in IMG/M |
| 3300009428|Ga0114915_1090553 | Not Available | 921 | Open in IMG/M |
| 3300009428|Ga0114915_1220639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 516 | Open in IMG/M |
| 3300009601|Ga0114914_1075055 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009605|Ga0114906_1220761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 628 | Open in IMG/M |
| 3300010149|Ga0098049_1085204 | unclassified Hyphomonas → Hyphomonas sp. | 993 | Open in IMG/M |
| 3300017730|Ga0181417_1064641 | unclassified Hyphomonas → Hyphomonas sp. | 890 | Open in IMG/M |
| 3300017730|Ga0181417_1161039 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 541 | Open in IMG/M |
| 3300017744|Ga0181397_1069498 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 950 | Open in IMG/M |
| 3300017745|Ga0181427_1149246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 566 | Open in IMG/M |
| 3300017751|Ga0187219_1231302 | unclassified Hyphomonas → Hyphomonas sp. | 502 | Open in IMG/M |
| 3300017755|Ga0181411_1153997 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 660 | Open in IMG/M |
| 3300017764|Ga0181385_1065300 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1125 | Open in IMG/M |
| 3300017767|Ga0181406_1039104 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300017767|Ga0181406_1221148 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 559 | Open in IMG/M |
| 3300017773|Ga0181386_1268387 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 502 | Open in IMG/M |
| 3300017782|Ga0181380_1170537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 736 | Open in IMG/M |
| 3300018420|Ga0181563_10528476 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300021960|Ga0222715_10209771 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300022074|Ga0224906_1063832 | unclassified Hyphomonas → Hyphomonas sp. | 1148 | Open in IMG/M |
| 3300022178|Ga0196887_1037740 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1302 | Open in IMG/M |
| 3300022925|Ga0255773_10332782 | Not Available | 605 | Open in IMG/M |
| 3300022929|Ga0255752_10095089 | All Organisms → Viruses → Predicted Viral | 1640 | Open in IMG/M |
| 3300024314|Ga0228657_1072119 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300025101|Ga0208159_1051298 | unclassified Hyphomonas → Hyphomonas sp. | 854 | Open in IMG/M |
| 3300025127|Ga0209348_1110562 | unclassified Hyphomonas → Hyphomonas sp. | 844 | Open in IMG/M |
| 3300025128|Ga0208919_1162569 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 687 | Open in IMG/M |
| 3300025137|Ga0209336_10077792 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 973 | Open in IMG/M |
| 3300025137|Ga0209336_10077892 | Not Available | 972 | Open in IMG/M |
| 3300025137|Ga0209336_10147827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 623 | Open in IMG/M |
| 3300025141|Ga0209756_1049197 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2074 | Open in IMG/M |
| 3300025151|Ga0209645_1035055 | unclassified Hyphomonas → Hyphomonas sp. | 1827 | Open in IMG/M |
| 3300025168|Ga0209337_1169711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300025237|Ga0208031_1018911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 929 | Open in IMG/M |
| 3300025266|Ga0208032_1060708 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 846 | Open in IMG/M |
| 3300025277|Ga0208180_1129295 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025282|Ga0208030_1104664 | Not Available | 709 | Open in IMG/M |
| 3300025282|Ga0208030_1118245 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 651 | Open in IMG/M |
| 3300025543|Ga0208303_1009070 | Not Available | 3148 | Open in IMG/M |
| 3300025652|Ga0208134_1030975 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1883 | Open in IMG/M |
| 3300025751|Ga0208150_1101427 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 941 | Open in IMG/M |
| 3300025759|Ga0208899_1036732 | All Organisms → Viruses → Predicted Viral | 2231 | Open in IMG/M |
| 3300025853|Ga0208645_1140921 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300026504|Ga0247587_1052480 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300027686|Ga0209071_1063944 | Not Available | 1100 | Open in IMG/M |
| 3300027771|Ga0209279_10052066 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1163 | Open in IMG/M |
| 3300028022|Ga0256382_1092246 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 725 | Open in IMG/M |
| 3300029319|Ga0183748_1017914 | All Organisms → Viruses → Predicted Viral | 2600 | Open in IMG/M |
| 3300029787|Ga0183757_1008163 | unclassified Hyphomonas → Hyphomonas sp. | 3174 | Open in IMG/M |
| 3300029787|Ga0183757_1011176 | unclassified Hyphomonas → Hyphomonas sp. | 2526 | Open in IMG/M |
| 3300029787|Ga0183757_1042683 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300031519|Ga0307488_10659421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 598 | Open in IMG/M |
| 3300031598|Ga0308019_10019643 | All Organisms → Viruses → Predicted Viral | 3088 | Open in IMG/M |
| 3300031598|Ga0308019_10054305 | All Organisms → Viruses → Predicted Viral | 1705 | Open in IMG/M |
| 3300031599|Ga0308007_10199638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 696 | Open in IMG/M |
| 3300031626|Ga0302121_10219468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 538 | Open in IMG/M |
| 3300031627|Ga0302118_10305673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 734 | Open in IMG/M |
| 3300031630|Ga0308004_10187074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 848 | Open in IMG/M |
| 3300031659|Ga0307986_10032622 | All Organisms → Viruses → Predicted Viral | 2865 | Open in IMG/M |
| 3300031675|Ga0302122_10337360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 521 | Open in IMG/M |
| 3300031696|Ga0307995_1061495 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
| 3300031702|Ga0307998_1163569 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 30.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 16.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.00% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.00% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100412132 | 3300000101 | Marine | MTNRTDDQIAQDYSAMLGSVSVITNVIDDSNEFCNDMT |
| DelMOSum2010_101721761 | 3300000101 | Marine | MTDRTDEQIAQDYSAMLGSVSVITNVIDDSNEFCND |
| DelMOSum2010_102757921 | 3300000101 | Marine | MARDADQIAQDYSAMLGSVSVITNVIDDDNPFCNDMTLAEKKE |
| DelMOSum2011_101772241 | 3300000115 | Marine | MTDRTDEQIAQDYSAMLGSVSVITNVIDDSNEFCN |
| DelMOSpr2010_102290072 | 3300000116 | Marine | MARDADQIAQDHAAMLGSVSVITNVIDDDNDFCNDMTLAKRKSV* |
| DelMOWin2010_100642912 | 3300000117 | Marine | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNEFCNDMT |
| JGI24006J15134_101962191 | 3300001450 | Marine | MTRETDQIAQDYSAMLGSVSVITNVIDDGNEFCNDMTTAE |
| JGI24006J15134_102217321 | 3300001450 | Marine | MTREADQIAQDYSAMLNSVNVIESVLDAKNDFYND |
| JGI24004J15324_100825612 | 3300001472 | Marine | MARETDQIAQDYSAMLGSVSVITNCLDDSNEFCNDMT |
| JGI24004J15324_100959702 | 3300001472 | Marine | MTRETDQVAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAE |
| JGI24004J15324_101028551 | 3300001472 | Marine | MTRETDQIVQDYSAMLGSVSVITNVIDDSNEFCNDMTT |
| JGI24004J15324_101151393 | 3300001472 | Marine | MTRETDQIAQDYSAMLGSVSVITNVIDDSNEFCNDMTTA |
| JGI24004J15324_101254061 | 3300001472 | Marine | MTRETDQMAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAE |
| JGI24005J15628_100905001 | 3300001589 | Marine | MTRETDQIVQDYSAMLGSVSVITNVIDDSNEFCNDMTTAEK |
| JGI25127J35165_10292151 | 3300002482 | Marine | MAESEARSDEQKAQDYSAMLGSVSVITNCLDDDDDFCSDMTSA |
| JGI25132J35274_10437782 | 3300002483 | Marine | MAESEXRSERSDEQKAQDYSAMLGSVSVITNCLDDDNDFCNDMT |
| JGI25128J35275_10241641 | 3300002488 | Marine | MAESEARSDEQKAKDYSAMLGSVSVITNCLDDDDDFCSDMTSAEKKE |
| Ga0072334_103858881 | 3300005086 | Water | MAESVERSDEQKAQDYSAMLGGVSVITNCLDDDNEFCNDMT |
| Ga0075441_100631862 | 3300006164 | Marine | MSREAAQIAQDHSALLGSVSVITNVIDDDNEFCNDMTLAEK |
| Ga0075441_102918421 | 3300006164 | Marine | MAREAAQIAQDHSALLGSVSVITNVIDDDNEFCNDMTLAEK |
| Ga0075445_100459122 | 3300006193 | Marine | MAREAAQIAQDHSAMLGSVSVITNVIDDDNEFCNDM |
| Ga0098048_10333411 | 3300006752 | Marine | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNDFCKDMTGE |
| Ga0098048_12128551 | 3300006752 | Marine | MAESEARSDEQKAQDYSAMLGSVSVITNCLDDDND |
| Ga0098055_12449081 | 3300006793 | Marine | MAESEARSDEQKAQDYSAMLGGVSVITNCLDDDNEFCND |
| Ga0070748_11885982 | 3300006920 | Aqueous | MAESVERSDEQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTS |
| Ga0098041_12415132 | 3300006928 | Marine | MSEETTRSDEQKAQDYSAMLGSVSVITNCLDDDNDFCN |
| Ga0098036_10813882 | 3300006929 | Marine | MAESEARSDEQKAQDYSAMLGSVSVITNCLDDDNDF |
| Ga0075444_100577971 | 3300006947 | Marine | MAREEAQIAQDHSAMLGSVSVITNVIDDNNEFCND |
| Ga0098046_10914072 | 3300006990 | Marine | MAESEARSDEQKAQDYSAMLGSVSVITNCLDDDNDFCN |
| Ga0070747_12609142 | 3300007276 | Aqueous | MSRDADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAE |
| Ga0070747_13212481 | 3300007276 | Aqueous | MAESEARSDEQIAQDYSAMLGSVSVITNCLDDDNEF |
| Ga0099849_10277923 | 3300007539 | Aqueous | MARDADQIAQDHAAMLGSVSVITNVIDDDNDFCNDM |
| Ga0114904_10200712 | 3300008218 | Deep Ocean | MARDADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTS |
| Ga0114910_10716652 | 3300008220 | Deep Ocean | MARDADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAEKKE |
| Ga0114910_10718531 | 3300008220 | Deep Ocean | MSREADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMT |
| Ga0114910_11161862 | 3300008220 | Deep Ocean | MSRDADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAEKKE |
| Ga0114910_11931662 | 3300008220 | Deep Ocean | MAREADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTSA |
| Ga0114908_10849262 | 3300009418 | Deep Ocean | MAREADQIAQDYSAMLGSVSVITNCLDDDNDFCNDMTSAEKKE |
| Ga0114908_11368421 | 3300009418 | Deep Ocean | MSREADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAE |
| Ga0114915_10905531 | 3300009428 | Deep Ocean | MERETAQIAQDYSAMLGSVSVITNVIDDSNEFCNDM |
| Ga0114915_12206391 | 3300009428 | Deep Ocean | MARDAEQIAQDHSAMLGSVSVITNVIDDSNDFCNDMTLAEKKERVA |
| Ga0114914_10750551 | 3300009601 | Deep Ocean | MAREAAQIAQDYSAMLGSVSVITNVLDADNKFCNDMTNDEKQE |
| Ga0114906_12207612 | 3300009605 | Deep Ocean | MSRDADQIAQDYSAMLGSVSVITNCLDDDNDFCNDMT |
| Ga0098049_10852041 | 3300010149 | Marine | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNEFCSDMTSAEK |
| Ga0181417_10646412 | 3300017730 | Seawater | MAESETRSDEQKAQDYSAMLGSVSVITNCLDDNNEFCN |
| Ga0181417_11610392 | 3300017730 | Seawater | MAESETVERSDEQKAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAEKKER |
| Ga0181397_10694981 | 3300017744 | Seawater | MSRDADQIAQDYSAMLGSVSVITNCLDDDNDFCNDMTSAEKK |
| Ga0181427_11492462 | 3300017745 | Seawater | MAREDAQIAQDYSAMLGSVSVITNCLDDSNEFCNDMTSA |
| Ga0187219_12313022 | 3300017751 | Seawater | MAESETRSDEQIAQDYSAMLGSVSVITNCLDDDDDFCSDMTSA |
| Ga0181411_11539971 | 3300017755 | Seawater | MARDADQIAQDYSAMLGSVSVITNCLDDDNDFCNDMTSAEKKERV |
| Ga0181385_10653002 | 3300017764 | Seawater | MAREADQIAQDYSAMLGSVSVITNCLDDNNEFCNDMT |
| Ga0181406_10391042 | 3300017767 | Seawater | MAESETRSDEQKAQDYSAMLGSVSVITNCLDDSNE |
| Ga0181406_12211481 | 3300017767 | Seawater | MAESEARSDEQKAQDYSAMLGSVSVITNCLDDADDFCNDMTS |
| Ga0181386_12683871 | 3300017773 | Seawater | MAESEARSDEQIAQDYSAMLGSVSVITNCLDDDDDFCSDMTSAEKKE |
| Ga0181380_11705372 | 3300017782 | Seawater | MARDADQIAQDYSAMLGSVSVITNCLDDNNEFCNDM |
| Ga0181563_105284762 | 3300018420 | Salt Marsh | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNDFCNDMTGEEKK |
| Ga0222715_102097711 | 3300021960 | Estuarine Water | MTDRTDEQIAQDYSAMLGSVSVITNVLDDDNDFGSDMTTD |
| Ga0224906_10638322 | 3300022074 | Seawater | MAREADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAE |
| Ga0196887_10377402 | 3300022178 | Aqueous | MSEETTRSDEQKAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAE |
| Ga0255773_103327821 | 3300022925 | Salt Marsh | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNEFCNDMTGEEKKE |
| Ga0255752_100950892 | 3300022929 | Salt Marsh | MAESEVVERSDEQKAQDYSAMLGSVSVITNCLDDDNDFCNDMTGEEKKE |
| Ga0228657_10721192 | 3300024314 | Seawater | MTDRTADQIAQDYSAMLGSVSVITNVLDDDNDFGSDMTTDEK |
| Ga0208159_10512981 | 3300025101 | Marine | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNDFCNDMTGEE |
| Ga0209348_11105621 | 3300025127 | Marine | MAESEARSDEQKAQDYSAMLGSVSVITNCLDDDNDFCNDMTSAEKK |
| Ga0208919_11625692 | 3300025128 | Marine | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNDFCNDMTGE |
| Ga0209336_100777921 | 3300025137 | Marine | MTRETDQIAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAEK |
| Ga0209336_100778922 | 3300025137 | Marine | MTRETDQVAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAEK |
| Ga0209336_101478271 | 3300025137 | Marine | MTRETDQMAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAEK |
| Ga0209756_10491971 | 3300025141 | Marine | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNEFCN |
| Ga0209645_10350551 | 3300025151 | Marine | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNDFCN |
| Ga0209337_11697111 | 3300025168 | Marine | MTDRTADQIAQDYSAMLGSVSVITNVLDDDNDFGSDMT |
| Ga0208031_10189111 | 3300025237 | Deep Ocean | MARKTAQIAQDYSAMLSSVSVITNVIDDSNEFCNDMTTAEKKARV |
| Ga0208032_10607082 | 3300025266 | Deep Ocean | MAREAAQIAQDYSAMLGSVSVITNVLDADNKFGNEKT |
| Ga0208180_11292952 | 3300025277 | Deep Ocean | MSRDADQIAQDYSAMLGSVSVITNCLDDDNDFCNDMTSAEKKER |
| Ga0208030_11046641 | 3300025282 | Deep Ocean | MSREADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAEKK |
| Ga0208030_11182451 | 3300025282 | Deep Ocean | MAREADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTS |
| Ga0208303_10090702 | 3300025543 | Aqueous | MAESEAVERSDEQKAQDYSAMLGSVSVITNCLDDDN |
| Ga0208134_10309751 | 3300025652 | Aqueous | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNDFCK |
| Ga0208150_11014272 | 3300025751 | Aqueous | MAESVERSDEQKAQDYSAMLGSVSVITNCLDDDNDF |
| Ga0208899_10367321 | 3300025759 | Aqueous | MAESEARSDEQKAQDYSAMLGSVSVITNCLDDDNEFCSDMT |
| Ga0208645_11409211 | 3300025853 | Aqueous | MTRETDQIAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAEKKER |
| Ga0247587_10524802 | 3300026504 | Seawater | MTDRTADQIAQDYSAMLGSVSVITNVLDDDNDFGSDMTTDEKKRTCGT |
| Ga0209071_10639441 | 3300027686 | Marine | MSRETAQIAQDHSAMLGSVSVITNVIDDDNEFCNDMTLAEKKERV |
| Ga0209279_100520662 | 3300027771 | Marine | MARETAQIAQDYSAMLSSVSVITNVIDDSNEFCND |
| Ga0256382_10922461 | 3300028022 | Seawater | MTDRTTEELAQDYSAMLGSVSVITNCLDDNNDFCNDM |
| Ga0183748_10179141 | 3300029319 | Marine | MAESEARSDEQKAQDYSAMLGSVSVITNCLDDSNEFCN |
| Ga0183757_10081632 | 3300029787 | Marine | MAREADQIAQDYSAMLGSVSVITNCLDDDNEFCND |
| Ga0183757_10111761 | 3300029787 | Marine | MSRDADQIAQDYSAMLGSVSVITNCLDDDNDFCKDMTSAEKKE |
| Ga0183757_10426831 | 3300029787 | Marine | MSREADQIAQDYSAMLGSVSVITNCLDDDNEFCNDMTSAEKKE |
| Ga0307488_106594211 | 3300031519 | Sackhole Brine | MARETDQIAQDYSAMLGSVSVITNVIDDSNEFCNDMTTDE |
| Ga0308019_100196431 | 3300031598 | Marine | MERETAQIAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAEKKAR |
| Ga0308019_100543052 | 3300031598 | Marine | MARETAQIAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAEKKAR |
| Ga0308007_101996382 | 3300031599 | Marine | MARETDQIAQDHSAMLGSVSVITNVIDDDNEFCNDM |
| Ga0302121_102194681 | 3300031626 | Marine | MAREADQIAQDYSAMLGSVSVITNVIDDDNDFCNDMTTDEKK |
| Ga0302118_103056732 | 3300031627 | Marine | MARDADQIAQDHAAMLGSVSVITNVIDDDNDFCNDL |
| Ga0308004_101870741 | 3300031630 | Marine | MARDAAQIAQDHSAMLGSVSVITNVIDDDNEFCNDLDLAGKKE |
| Ga0307986_100326221 | 3300031659 | Marine | MTRDAEQIAQDHSAMLGSVSVITNVIDDDNDFCNDMT |
| Ga0302122_103373601 | 3300031675 | Marine | MARDADQIAQDHSAMLGSVSVITNVIDDDNDFCNDLDLAGKKERVA |
| Ga0307995_10614952 | 3300031696 | Marine | MARDADQIAQDYSAMLGSVSVITNVIDDDNEFCNDMTTDEKK |
| Ga0307998_11635691 | 3300031702 | Marine | MERETAQIAQDYSAMLGSVSVITNVIDDSNEFCNDMTTAEKKARVARSMSYI |
| ⦗Top⦘ |