 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105913 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MTNYNKDAVEKAISTSKKPISKKEAKLIHALLKGHK |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.67 % |
| % of genes near scaffold ends (potentially truncated) | 1.00 % |
| % of genes from short scaffolds (< 2000 bps) | 4.00 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (94.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (36.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.81% β-sheet: 0.00% Coil/Unstructured: 67.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 3.00 |
| PF03237 | Terminase_6N | 2.00 |
| PF03592 | Terminase_2 | 2.00 |
| PF00476 | DNA_pol_A | 1.00 |
| PF13538 | UvrD_C_2 | 1.00 |
| PF02794 | HlyC | 1.00 |
| PF13539 | Peptidase_M15_4 | 1.00 |
| PF01653 | DNA_ligase_aden | 1.00 |
| PF00004 | AAA | 1.00 |
| PF01381 | HTH_3 | 1.00 |
| PF03796 | DnaB_C | 1.00 |
| PF01521 | Fe-S_biosyn | 1.00 |
| PF12728 | HTH_17 | 1.00 |
| PF07486 | Hydrolase_2 | 1.00 |
| PF12705 | PDDEXK_1 | 1.00 |
| PF05565 | Sipho_Gp157 | 1.00 |
| PF05866 | RusA | 1.00 |
| PF00478 | IMPDH | 1.00 |
| PF13481 | AAA_25 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 3.00 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 2.00 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 1.00 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.00 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.00 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.00 |
| COG2994 | ACP:hemolysin acyltransferase (hemolysin-activating protein) | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 1.00 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 1.00 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 94.00 % |
| All Organisms | root | All Organisms | 6.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 36.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 5.00% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.00% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.00% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.00% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.00% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.00% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.00% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007668 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D2_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300008963 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_101037294 | 3300000117 | Marine | MTNYNKDAVEKAISTSKKPISKKEAKLIHALLKGHK* |
| JGI20157J14317_100336277 | 3300001352 | Pelagic Marine | MAYNKDAVNSAIATSRKPVSSKEVKLIHSLLKGHS* |
| JGI24006J15134_100093243 | 3300001450 | Marine | MTDYNKDAVEKAISTSKKPISKKEAKLIHALLKGNK* |
| JGI24006J15134_100094144 | 3300001450 | Marine | MYNKKSIDKAIKASSKPISKKETKLIHALLKGHWSKSK* |
| JGI24003J15210_1000482711 | 3300001460 | Marine | MANYEKTAVDKAIATSKKPISKKEAKLIHALLKGHKK* |
| JGI24004J15324_100200702 | 3300001472 | Marine | VNTYNKEAVEKAIKTSRKPISKKEAKLIHALLKGRKL* |
| JGI24004J15324_100203704 | 3300001472 | Marine | MENISYNKKSIDKAINASKKPIKKKEAKLIHALLKGHAK* |
| JGI24004J15324_100347934 | 3300001472 | Marine | MTNYNKDAVDKAIKTSNQPISKKEAKLIHALLKGNK* |
| JGI24005J15628_100293103 | 3300001589 | Marine | MTTYNKDSVTKAIKADKTIGKKEAKLIHAILKGHGK* |
| JGI24005J15628_100491614 | 3300001589 | Marine | VSKVIYDKEAVQKAIELSRKPISKSELKLIHALLKGHSK* |
| Ga0074476_11424502 | 3300005825 | Sediment (Intertidal) | MSYNKEAVEKAIKTSRKPISGKEAKLIHALLKGRK* |
| Ga0075109_10733742 | 3300005912 | Saline Lake | MSTYNKESVEKAIKASSKPISKKEGKLIHKLLKGHS* |
| Ga0070743_100671612 | 3300005941 | Estuarine | MAYNKDAVDKAIATSRKPISGKEAKLIHALLKGRK* |
| Ga0075466_10019657 | 3300006029 | Aqueous | MSKYNEKAVEKAIKSSKKPIKTKEAKLIHKLLKGHSR* |
| Ga0075441_100882062 | 3300006164 | Marine | MYNKKSIDKAIKVSNKPISKKETKLIHALLKGHWSKSK* |
| Ga0068468_100061742 | 3300006305 | Marine | MTNYDKNAVDKAIATSTKPISKKEAKLIHALLKGNK* |
| Ga0098038_10090896 | 3300006735 | Marine | MANYDKTAVDKAIATSKKPISKKEAKLIHALLKGNKK* |
| Ga0098037_10275952 | 3300006737 | Marine | MTNYDKDAVDKAITTSTKPISKKEAKLIHALLKGNK* |
| Ga0098042_10183533 | 3300006749 | Marine | MNKYNKKAVENLIKQDKSISKKEAKLIHALLKGRN* |
| Ga0098042_10663521 | 3300006749 | Marine | MNKYNKKAVRKLIKQDKSISKKEAKLIHALLKGRN* |
| Ga0098042_11445592 | 3300006749 | Marine | MTNYDKDAVDKAIATSTKPISKKEAKLIHALLKGNK* |
| Ga0070749_1002566711 | 3300006802 | Aqueous | MSEYNKEAVEKAIKSSSKPISKKEAKLIHALLKGRS* |
| Ga0070750_103164782 | 3300006916 | Aqueous | MTNYNKDAVEKAISTSKKPISKKEAKLIHALLKGH |
| Ga0070747_11252383 | 3300007276 | Aqueous | MSTYKKESVEKAIKSSAKPISKKEGKLIHKLLKGH |
| Ga0099849_11738263 | 3300007539 | Aqueous | MANYDKDAVDKAIKTSSKPISKKEAKLIHALLKGHSNG* |
| Ga0099848_10848682 | 3300007541 | Aqueous | MAYNKDAVDQAIATSRKPISGKEAKLIHALLKGRK* |
| Ga0099848_11666733 | 3300007541 | Aqueous | MATYNKEAVDQAIKTSRQPISKKEARLIHALLKGRKAQG |
| Ga0102945_10145162 | 3300007609 | Pond Water | MAYNKDAVDNTIANSRKPVSSKEAKLIRALLKGHS* |
| Ga0102935_13140481 | 3300007668 | Pond Soil | MAYNKHSVDRAISTSRKPVSGKEAKLIHKLLKGHSK* |
| Ga0099850_11551602 | 3300007960 | Aqueous | MAYNKDAVDRAIATSRKPISGKEAKLIHALLKGRG* |
| Ga0114905_11014941 | 3300008219 | Deep Ocean | PRKMTVYNKAAVEKAIQKDKTISKKDAKLIHALLKGHQKQNL* |
| Ga0114910_12227902 | 3300008220 | Deep Ocean | MTVYNKAAVEKAIQKDKTISKKDAKLIHALLKGHQKQNL* |
| Ga0102930_10097529 | 3300008963 | Pond Water | MMYNADSVEKAIQTSSKPISKKQGKLIHALLKGHATQ* |
| Ga0114915_10374065 | 3300009428 | Deep Ocean | MYNKKSIDKAIKASSKPISKKETKLIHALLKGHLNR* |
| Ga0114915_11344761 | 3300009428 | Deep Ocean | KMYNKKSIDKAIKASSKPISKKETKLIHALLKGHLIRSKTK* |
| Ga0114932_100192417 | 3300009481 | Deep Subsurface | MRTYNKEAVEKAIKTSPIPISKKEAKLIHALLKGRTNTK* |
| Ga0115003_102151652 | 3300009512 | Marine | MYNKKSIDKAIKVSSKPISKKEAKLIHALLKGYRSKLK* |
| Ga0115013_100297008 | 3300009550 | Marine | MKNKYNKEAVDRVIKQDKTISKKEAKLIHSLLKGNY* |
| Ga0115013_114802122 | 3300009550 | Marine | MNNKYNKQAVDKLIKRDKSISKKEAKLIHELLKGR |
| Ga0115011_100538745 | 3300009593 | Marine | MTNYDKAAVDKAIATSTKPISKKEAKLIHALLKGNK* |
| Ga0115011_102996012 | 3300009593 | Marine | MANYNKAAVDKAIATSSKPISKNEAKLIHSLLKKGNK* |
| Ga0114999_1000331043 | 3300009786 | Marine | MNGYNKDAVTKEITKDPSISKKGAKLIHALLKGRG* |
| Ga0115012_110875292 | 3300009790 | Marine | MTNYNKAAVDKAIATSSKPISKNEAKLIHSLLKKGNK* |
| Ga0098043_11916313 | 3300010148 | Marine | MTNYDKEAVDKAITTSTKPISKKEAKLIHALLRGNK* |
| Ga0129351_13082702 | 3300010300 | Freshwater To Marine Saline Gradient | RGALNMSTYNKESVEKAIKSSAKPISKKEGKLIHKLLKGHS* |
| Ga0160423_100467192 | 3300012920 | Surface Seawater | MKNKYNKEAVDRVIEQDKTISKKEAKLIHALLKGKL* |
| Ga0181391_11547212 | 3300017713 | Seawater | KMTDYNKDAVEKTIQKDKTISKKDAKLIHALLKEHQK |
| Ga0181412_11596632 | 3300017714 | Seawater | MANYNKDAVDKAIKTSKQPISKKEAKLIHALLKGYK |
| Ga0181383_10569612 | 3300017720 | Seawater | MTDYNKDAVEKTIQKDKTISKKDAKLIHALLKGHQKQNF |
| Ga0181398_11237483 | 3300017725 | Seawater | MKNISYNKKSIDKAINASKKPIKKKEAKLIHALLKGHAK |
| Ga0181382_10667062 | 3300017756 | Seawater | MTDYNKDAVEKAIQKDKTISKKYAKLIHALLKGHQK |
| Ga0181565_100020052 | 3300017818 | Salt Marsh | MAYNKESVNRAIATSRKPISGKEAKLIHALLKGRG |
| Ga0181565_1002103616 | 3300017818 | Salt Marsh | MSYNKEAVEKAIATSRKPISGKEAKLIHALLKGRK |
| Ga0181565_101489514 | 3300017818 | Salt Marsh | MATYNKEAVDEAIKSSNKFGQKITKKEAKLIHALLKGRGK |
| Ga0181565_106034304 | 3300017818 | Salt Marsh | FNEKGNVMAAYDKAAVDKAIKTSSKPISKKEAKLIHALLKGRSNG |
| Ga0181583_107617931 | 3300017952 | Salt Marsh | MAAYDKAAVDKAIKTSSKPISKKEAKLIHALLKGRSNG |
| Ga0181592_100744352 | 3300018421 | Salt Marsh | MSYNKESVDKAIATSRKPISGKEAKLIHALLKGRG |
| Ga0181570_101068771 | 3300020207 | Salt Marsh | MSNYDQAAVDKAIKTSSKPISKKEAKLIHALLKGRSNG |
| Ga0211707_10183851 | 3300020246 | Marine | MKNKYNKEAVDKLIKRDKSISKKEAQLIHALLKGNH |
| Ga0211636_104118042 | 3300020400 | Marine | MKNKYDKKAVDKLIKLDKSISKKKAKLIHALLKGRN |
| Ga0211659_100701142 | 3300020404 | Marine | MNKYNKKAVENLIKQDKSISKKEAKLIHALLKGRN |
| Ga0211651_100216067 | 3300020408 | Marine | MKNKYNKEAIDRAIKQDKTISKKQAKSIHALLKGNY |
| Ga0211708_102382032 | 3300020436 | Marine | MKNKYNKEAVDRAIKQDKTISKKEAKLIHSLLKGNY |
| Ga0211577_1000181527 | 3300020469 | Marine | MTDYNKDAVEKTIQKDKTISKKDAKLIHALLRGHQKQNF |
| Ga0210295_11818024 | 3300021323 | Estuarine | MSYNKEAVEKAIKTSRKPISGKEAKLIHALLKGRK |
| Ga0213858_100192033 | 3300021356 | Seawater | MSYNKESVNKAIATSRKPISGKEAKLIHALLKGRG |
| Ga0212030_10231042 | 3300022053 | Aqueous | MSKYNEKAVEKAIKSSKKPIKTKEAKLIHKLLKGHSR |
| Ga0196889_10412262 | 3300022072 | Aqueous | MTNYNKDAVEKAISTSKKPISKKEAKLIHALLKGHK |
| Ga0224906_10102927 | 3300022074 | Seawater | MENISYNKKSIDKAINASKKPIKKKEAKLIHALLKGHAK |
| Ga0212031_10079814 | 3300022176 | Aqueous | MSEYNKEAVEKAIKSSSKPISKKEAKLIHALLKGRS |
| Ga0212031_10833762 | 3300022176 | Aqueous | MAYNKDAVDQAIATSRKPISGKEAKLIHALLKGRK |
| Ga0222673_100100510 | 3300022821 | Saline Water | MSTYNKESVEKAIKASSKPISKKEGKLIHKLLKGHS |
| (restricted) Ga0255039_100808712 | 3300024062 | Seawater | MSTYNKESVEKAIKSSAKPISKKEGKLIHKLLKGHS |
| Ga0244777_1000066023 | 3300024343 | Estuarine | MAYNKDAVDKAIATSRKPISGKEAKLIHALLKGRK |
| Ga0207896_10005528 | 3300025071 | Marine | MTDYNKDAVEKAISTSKKPISKKEAKLIHALLKGNK |
| Ga0208157_10684962 | 3300025086 | Marine | MANYDKTAVDKAIATSKKPISKKEAKLIHALLKGNKK |
| Ga0208159_10949341 | 3300025101 | Marine | MNKYNKKAVRKLIKQDKSISKKEAKLIHALLKGRN |
| Ga0209535_11659183 | 3300025120 | Marine | MYNKKSIDKAIKASSKPISKKETKLIHALLKGHWSKSK |
| Ga0209232_10426083 | 3300025132 | Marine | MANYNKDAVDKAIKTSKQPISKKEAKLIHALLKGHK |
| Ga0209336_100023504 | 3300025137 | Marine | MTNYNKDAVDKAIKTSNQPISKKEAKLIHALLKGNK |
| Ga0209336_100321863 | 3300025137 | Marine | VNTYNKEAVEKAIKTSRKPISKKEAKLIHALLKGRKL |
| Ga0209336_101563412 | 3300025137 | Marine | MTNYNKEAVEKAIKTSRKPISKKEAKLIHALLKGRKV |
| Ga0209634_100307120 | 3300025138 | Marine | MTTYNKDSVTKAIKADKTIGKKEAKLIHAILKGHGK |
| Ga0209634_100864110 | 3300025138 | Marine | MANYEKTAVDKAIATSKKPISKKEAKLIHALLKGHKK |
| Ga0209645_10328941 | 3300025151 | Marine | MANYNKDAVDKAIKTSKQPISKKEAKLIHALLKGNK |
| Ga0209337_12821981 | 3300025168 | Marine | MYNKKSIDKAIKASSKPISKKETKLIHALLKGHLIRSKIK |
| Ga0208450_11372582 | 3300025301 | Deep Ocean | MTVYNKAAVEKAIQKDKTISKKDAKLIHALLKGHQKQNL |
| Ga0208134_11178781 | 3300025652 | Aqueous | MSTYKKESVEKAIKSSAKPISKKEGKLIHKLLKGHS |
| Ga0208162_12022942 | 3300025674 | Aqueous | MANYDKDAVDKAIKTSSKPISKKEAKLIHALLKGHSNG |
| Ga0209534_100413439 | 3300025880 | Pelagic Marine | MAYNKDAVNSAIATSRKPVSSKEVKLIHSLLKGHS |
| Ga0209953_10122444 | 3300026097 | Pond Water | MAYNKDAVDNTIANSRKPVSSKEAKLIRALLKGHS |
| Ga0209815_12345162 | 3300027714 | Marine | MYNKKSIDKAIKVSNKPISKKETKLIHALLKGHWSKSK |
| Ga0209503_100237016 | 3300027859 | Marine | MNNKYNKQAVDKLIKRDKSISKKEAKLIHELLKGRN |
| Ga0209404_101399084 | 3300027906 | Marine | MTNYDKAAVDKAIATSTKPISKKEAKLIHALLKGNK |
| Ga0209404_106111642 | 3300027906 | Marine | MANYNKAAVDKAIATSSKPISKNEAKLIHSLLKKGNK |
| Ga0185543_10439872 | 3300029318 | Marine | MTNYDKDAVDKAIATSTKPISKKEAKLIHALLKGNK |
| Ga0183748_100369210 | 3300029319 | Marine | MKNKYNKEAIDRAIKQDKTISKKEAKLIHALLKGNY |
| Ga0183757_10139433 | 3300029787 | Marine | MTPYNKEAVEKAIKKSKETISTKEAKIIHALLKGHQSTEGK |
| Ga0307488_108434092 | 3300031519 | Sackhole Brine | MYNKKSIDKAIKVSSKPISKKEAKLIHALLKGYRSKLK |
| Ga0310343_100241014 | 3300031785 | Seawater | MTNYDKNAVDKAIATSTKPISKKEAKLIHALLKGNK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |