| Basic Information | |
|---|---|
| Family ID | F105869 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MIALYPGAFKPPHRGHFEVVKSLLNGSHGGQVYNKDNYK |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.19 % |
| % of genes near scaffold ends (potentially truncated) | 90.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (19.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 0.00% Coil/Unstructured: 80.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF06414 | Zeta_toxin | 17.00 |
| PF01930 | Cas_Cas4 | 2.00 |
| PF13362 | Toprim_3 | 1.00 |
| PF00873 | ACR_tran | 1.00 |
| PF06737 | Transglycosylas | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 2.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.00 % |
| All Organisms | root | All Organisms | 19.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000928|OpTDRAFT_10264411 | Not Available | 922 | Open in IMG/M |
| 3300001460|JGI24003J15210_10095752 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 861 | Open in IMG/M |
| 3300001936|GOS2220_1021551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1820 | Open in IMG/M |
| 3300003216|JGI26079J46598_1033398 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1155 | Open in IMG/M |
| 3300003617|JGI26082J51739_10059533 | Not Available | 1132 | Open in IMG/M |
| 3300004097|Ga0055584_101490580 | Not Available | 702 | Open in IMG/M |
| 3300004448|Ga0065861_1170914 | Not Available | 580 | Open in IMG/M |
| 3300005605|Ga0066850_10287058 | Not Available | 582 | Open in IMG/M |
| 3300006165|Ga0075443_10399324 | Not Available | 515 | Open in IMG/M |
| 3300006484|Ga0070744_10126317 | Not Available | 736 | Open in IMG/M |
| 3300006621|Ga0101441_100401 | Not Available | 113607 | Open in IMG/M |
| 3300006793|Ga0098055_1159544 | Not Available | 866 | Open in IMG/M |
| 3300006870|Ga0075479_10195396 | Not Available | 814 | Open in IMG/M |
| 3300006916|Ga0070750_10335029 | Not Available | 641 | Open in IMG/M |
| 3300006925|Ga0098050_1110075 | Not Available | 701 | Open in IMG/M |
| 3300007344|Ga0070745_1191559 | Not Available | 759 | Open in IMG/M |
| 3300009001|Ga0102963_1188398 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 825 | Open in IMG/M |
| 3300009027|Ga0102957_1338025 | Not Available | 555 | Open in IMG/M |
| 3300009086|Ga0102812_10564032 | Not Available | 623 | Open in IMG/M |
| 3300009086|Ga0102812_10571353 | Not Available | 619 | Open in IMG/M |
| 3300009606|Ga0115102_10252145 | Not Available | 594 | Open in IMG/M |
| 3300010149|Ga0098049_1100963 | Not Available | 903 | Open in IMG/M |
| 3300010149|Ga0098049_1276111 | Not Available | 509 | Open in IMG/M |
| 3300010318|Ga0136656_1162836 | Not Available | 759 | Open in IMG/M |
| 3300012954|Ga0163111_11172242 | Not Available | 749 | Open in IMG/M |
| 3300017710|Ga0181403_1121156 | Not Available | 546 | Open in IMG/M |
| 3300017714|Ga0181412_1071855 | Not Available | 843 | Open in IMG/M |
| 3300017719|Ga0181390_1158715 | Not Available | 564 | Open in IMG/M |
| 3300017731|Ga0181416_1063911 | Not Available | 870 | Open in IMG/M |
| 3300017739|Ga0181433_1007097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3186 | Open in IMG/M |
| 3300017740|Ga0181418_1086002 | Not Available | 765 | Open in IMG/M |
| 3300017740|Ga0181418_1098983 | Not Available | 707 | Open in IMG/M |
| 3300017742|Ga0181399_1009385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2894 | Open in IMG/M |
| 3300017743|Ga0181402_1033702 | Not Available | 1420 | Open in IMG/M |
| 3300017744|Ga0181397_1191651 | Not Available | 513 | Open in IMG/M |
| 3300017745|Ga0181427_1020064 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1669 | Open in IMG/M |
| 3300017779|Ga0181395_1096276 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 950 | Open in IMG/M |
| 3300018428|Ga0181568_10567890 | Not Available | 897 | Open in IMG/M |
| 3300019077|Ga0188868_1000348 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
| 3300020175|Ga0206124_10180718 | Not Available | 839 | Open in IMG/M |
| 3300020188|Ga0181605_10316609 | Not Available | 648 | Open in IMG/M |
| 3300020191|Ga0181604_10369158 | Not Available | 629 | Open in IMG/M |
| 3300020436|Ga0211708_10143893 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 946 | Open in IMG/M |
| 3300020438|Ga0211576_10660561 | Not Available | 515 | Open in IMG/M |
| 3300020440|Ga0211518_10227655 | Not Available | 905 | Open in IMG/M |
| 3300020474|Ga0211547_10377108 | Not Available | 715 | Open in IMG/M |
| 3300021347|Ga0213862_10142827 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 842 | Open in IMG/M |
| 3300021957|Ga0222717_10418773 | Not Available | 737 | Open in IMG/M |
| 3300021962|Ga0222713_10493302 | Not Available | 734 | Open in IMG/M |
| 3300022068|Ga0212021_1109010 | Not Available | 567 | Open in IMG/M |
| 3300022074|Ga0224906_1175541 | Not Available | 594 | Open in IMG/M |
| 3300022198|Ga0196905_1154553 | Not Available | 589 | Open in IMG/M |
| 3300022921|Ga0255765_1190598 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 919 | Open in IMG/M |
| 3300023170|Ga0255761_10303789 | Not Available | 834 | Open in IMG/M |
| 3300023568|Ga0228696_1008637 | Not Available | 1178 | Open in IMG/M |
| 3300023693|Ga0232112_1023720 | Not Available | 684 | Open in IMG/M |
| 3300023702|Ga0232119_1005925 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77 | 1874 | Open in IMG/M |
| 3300023702|Ga0232119_1013310 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1272 | Open in IMG/M |
| 3300024228|Ga0228633_1034389 | Not Available | 1333 | Open in IMG/M |
| 3300024228|Ga0228633_1057776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 964 | Open in IMG/M |
| 3300024229|Ga0233402_1064623 | Not Available | 770 | Open in IMG/M |
| 3300024247|Ga0228675_1095332 | Not Available | 555 | Open in IMG/M |
| 3300024266|Ga0228661_1069044 | Not Available | 657 | Open in IMG/M |
| 3300024318|Ga0233400_1086654 | Not Available | 725 | Open in IMG/M |
| 3300024335|Ga0228672_1096920 | Not Available | 833 | Open in IMG/M |
| 3300024346|Ga0244775_10223038 | Not Available | 1576 | Open in IMG/M |
| 3300024346|Ga0244775_10838575 | Not Available | 733 | Open in IMG/M |
| 3300024346|Ga0244775_11206369 | Not Available | 589 | Open in IMG/M |
| 3300025137|Ga0209336_10143218 | Not Available | 637 | Open in IMG/M |
| 3300025138|Ga0209634_1317047 | Not Available | 528 | Open in IMG/M |
| 3300025674|Ga0208162_1196642 | Not Available | 515 | Open in IMG/M |
| 3300025676|Ga0209657_1118234 | Not Available | 787 | Open in IMG/M |
| 3300025770|Ga0209362_1091472 | Not Available | 1158 | Open in IMG/M |
| 3300026138|Ga0209951_1126386 | Not Available | 516 | Open in IMG/M |
| 3300026470|Ga0247599_1097155 | Not Available | 616 | Open in IMG/M |
| 3300026495|Ga0247571_1035245 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1097 | Open in IMG/M |
| 3300027197|Ga0208922_1040110 | Not Available | 808 | Open in IMG/M |
| 3300027631|Ga0208133_1161992 | Not Available | 515 | Open in IMG/M |
| 3300027751|Ga0208304_10157199 | Not Available | 834 | Open in IMG/M |
| 3300027753|Ga0208305_10196267 | Not Available | 727 | Open in IMG/M |
| 3300027757|Ga0208671_10296057 | Not Available | 571 | Open in IMG/M |
| 3300027788|Ga0209711_10465316 | Not Available | 503 | Open in IMG/M |
| 3300027808|Ga0209354_10404861 | Not Available | 530 | Open in IMG/M |
| 3300027906|Ga0209404_10983461 | Not Available | 578 | Open in IMG/M |
| 3300028008|Ga0228674_1112972 | Not Available | 937 | Open in IMG/M |
| 3300028109|Ga0247582_1007499 | All Organisms → Viruses → Predicted Viral | 2386 | Open in IMG/M |
| 3300028124|Ga0228621_1066939 | Not Available | 542 | Open in IMG/M |
| 3300028196|Ga0257114_1255159 | Not Available | 623 | Open in IMG/M |
| 3300028279|Ga0228613_1012979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1907 | Open in IMG/M |
| 3300028391|Ga0233394_1095060 | Not Available | 626 | Open in IMG/M |
| 3300031519|Ga0307488_10656849 | Not Available | 600 | Open in IMG/M |
| 3300031766|Ga0315322_10715247 | Not Available | 628 | Open in IMG/M |
| 3300032047|Ga0315330_10363194 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 900 | Open in IMG/M |
| 3300032088|Ga0315321_10796383 | Not Available | 537 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 19.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.00% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.00% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.00% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.00% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.00% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.00% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.00% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001936 | Marine microbial communities from Halifax, Nova Scotia, Canada - GS004 | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006621 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time point | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019077 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p8 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023568 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023693 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023702 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
| 3300024266 | Seawater microbial communities from Monterey Bay, California, United States - 75D | Environmental | Open in IMG/M |
| 3300024318 | Seawater microbial communities from Monterey Bay, California, United States - 46D | Environmental | Open in IMG/M |
| 3300024335 | Seawater microbial communities from Monterey Bay, California, United States - 90D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026470 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026495 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028124 | Seawater microbial communities from Monterey Bay, California, United States - 25D | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028279 | Seawater microbial communities from Monterey Bay, California, United States - 14D | Environmental | Open in IMG/M |
| 3300028391 | Seawater microbial communities from Monterey Bay, California, United States - 24D | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OpTDRAFT_102644112 | 3300000928 | Freshwater And Marine | MIALYPGAYKPPHRGHFNVVKSLLDNSYNGSVYDKD |
| JGI24003J15210_100957521 | 3300001460 | Marine | MIALYPGAFKPPHRGHFEVVKGLLNGSHGGQVYDIDSYAEAGTSVLQGKKNNVKKIN |
| GOS2220_10215512 | 3300001936 | Marine | MIALYPGAFKPPHRGHFEVVKSLLNGNHGGKVYDIESYIDAGTSVLQGSGDELEKINNG |
| JGI26079J46598_10333981 | 3300003216 | Marine | MRSVLYPGAFKPPHRGHFEVVKRLLNNNHGGHPYNVDTTYDAGTDALGGKESTAE |
| JGI26082J51739_100595332 | 3300003617 | Marine | MRSVLYSGAFKPPHRGHFEVVKRLLNNTHGGQPYDIDSHKEAGTSALS |
| Ga0055584_1014905801 | 3300004097 | Pelagic Marine | MIALYPGAFKPPHRGHFEVVKRLLNGTHKGKVYDIEDYQDAGLKALS |
| Ga0065861_11709142 | 3300004448 | Marine | MTALYPGAFKPPHRGHFEVVKSLLNGSHGGQVYNKDNYKDAGTSSLSGKKGKVE |
| Ga0066850_102870582 | 3300005605 | Marine | MIALYPGAFKPPHRGHFNVVKSLLDGSYNGTTYNKDDYQDKASSLFK |
| Ga0075443_103993242 | 3300006165 | Marine | MAIALYPGAFKPPHKGHFEVAKLLLNGSYNGQVYN |
| Ga0070744_101263171 | 3300006484 | Estuarine | MIALYPGAFKPPHRGHFEVVKSLLNGSHGGQVYNKDNYK |
| Ga0101441_100401186 | 3300006621 | Marine Surface Water | MIALYPGAFKPPHRGHFNVVKTLLDGSYNGAVYTKDDYKEKGAA |
| Ga0098055_11595441 | 3300006793 | Marine | MIALYPGAFKPPHRGHFEVVKRLLKVNHGGHVYSIDNYQDAGTKA |
| Ga0075479_101953962 | 3300006870 | Aqueous | MIALYPGAFKPPHRGHFNVVKTLLDGSYNGAVYTKDDYK |
| Ga0070750_103350291 | 3300006916 | Aqueous | MIALYPGAFKPPHRGHFEVVKRLLNGTHKGEVYDIEDYQDAG |
| Ga0098050_11100752 | 3300006925 | Marine | MIALYPGAFKPPHRGHFEVVKSLLNGTHGGQVYTKDNYKDAGTSSLTGKKSIVDKIDK |
| Ga0070745_11915592 | 3300007344 | Aqueous | MIALYPGAFKPPHRGHFEVVKSLLNGTHGGKIYNVDSYKQAGLGALSKE |
| Ga0102963_11883981 | 3300009001 | Pond Water | MIALYPGAYKPPHRGHFEVVKRLLNGTHKGKVYDIEDYQDA |
| Ga0102810_10675712 | 3300009002 | Estuarine | MATALYPGGFKPPHRGHFEVVKKLLSNTHGGKLYNFDDREEA |
| Ga0102957_13380252 | 3300009027 | Pond Water | MIALYPGAYKPPHRGHFEVVKRLFNGTHKGKVYDIEDYQDAGLKALSSEESTAEKI |
| Ga0102812_105640322 | 3300009086 | Estuarine | MAVALYPGAFKPPHRGHFEVVKRLLKGTHDGKPYTLDNYKDVG |
| Ga0102812_105713531 | 3300009086 | Estuarine | MIALYPGAYKPPHRGHFNVVKSLLDGSYNGSVYNKDNYKETG |
| Ga0115102_102521452 | 3300009606 | Marine | MIALYPGAFKPPHRGHFNVVKSLLDGSYNGKVYDKDNYKDVGADILSN |
| Ga0098049_11009633 | 3300010149 | Marine | MIALYPGAFKPPHRGHFEVVKSLLNGTHGGQVYTKDNYKDAGT |
| Ga0098049_12761112 | 3300010149 | Marine | MIALYPGAFKPPHKGHFQVVKSLLDGSYNGNVYTK |
| Ga0136656_11628361 | 3300010318 | Freshwater To Marine Saline Gradient | MIALYPGAFKPPHRGHFEVVKSLLNGSHGGKVYDIDSYAEAGMGALKGQPDNLQ |
| Ga0163111_111722423 | 3300012954 | Surface Seawater | MIALYPGAFKPPHRGHFEVVKSLLNGNHNGVEYSIDNY |
| Ga0181403_11211561 | 3300017710 | Seawater | MIALYPGAFKPPHRGHFEVVKSLLNGTHGGQVYTKDNYKDAGI |
| Ga0181412_10718552 | 3300017714 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDGTYNGSIYDKDNYKETGAELLK |
| Ga0181390_11587152 | 3300017719 | Seawater | MIALYPGAFKPPHRGHFNVVKSLLDGSYNGSIYDKD |
| Ga0181416_10639112 | 3300017731 | Seawater | MIALYPGAFKPPHRGHFDVVKDLLSNSHKGKVYDIDNYLDAGAEVL |
| Ga0181433_10070975 | 3300017739 | Seawater | MIALYPGAFKPPHRGHFNVVKSLLDGSYNGSIYDKDNYKEKGIDLV |
| Ga0181418_10860022 | 3300017740 | Seawater | MAIALYPGGFKPPHRGHFEVVKKLLSNTHGGKLYNFDD |
| Ga0181418_10989831 | 3300017740 | Seawater | MIALYPGAFKPPHKGHFNVVKNLLSGNFYGTEYAFDD |
| Ga0181399_10093856 | 3300017742 | Seawater | MIALYPGAFKPPHRGHFEVVKSLLNGTHGGQVYTKDNYKDAGTSSLSGK |
| Ga0181402_10337021 | 3300017743 | Seawater | MIALYPGAFKPPHRGHFEVVKSLLNGTHNGQVYTKDN |
| Ga0181397_11916512 | 3300017744 | Seawater | MIAFYPGAFKPPHRGHFNVVKSLLDGSYNGSVYNKDNYK |
| Ga0181427_10200643 | 3300017745 | Seawater | MIALYPGAFKPPHRGHFDVVKDLLSNSHKGKVYDIDNYLDAGEE |
| Ga0181420_10244791 | 3300017757 | Seawater | MATALYPGGFKPPHRGHFEVVKKLLSNTHGGKLYNFDD |
| Ga0181395_10962762 | 3300017779 | Seawater | MIAFYPGAFKPPHRGHFNVVKSLLDGSYNGSVYNKDNYKDTGA |
| Ga0181600_1001878910 | 3300018036 | Salt Marsh | MATALYPGGFKPPHGGHFEVVKRLLNNTHNGKVYNFDDRETA |
| Ga0181568_105678902 | 3300018428 | Salt Marsh | MAIALYPGAFKPPHRGHFEVVKKLLNGTHGGKLYDADSYKDVGKAALAGESYKVEK |
| Ga0188868_10003483 | 3300019077 | Freshwater Lake | MIALYPGAYKPPHRGHFNVVKSLLDNTYNGSIYDKDNYKETGIELLK |
| Ga0206124_101807181 | 3300020175 | Seawater | MIALYPGAFKPPHRGHFEVVKRLLNGTHKGKVYDIEDYQDAGLKALSPEESTAEKID |
| Ga0181605_103166092 | 3300020188 | Salt Marsh | MIALYPGAFKPPHRGHFNVVKSLLDGSYNGTIYNKDNY |
| Ga0181604_103691582 | 3300020191 | Salt Marsh | MAIALYPGAFKPPHRGHFEVVKKLLNGTHGGKLYGVDSYKDVGNSFSRLEX |
| Ga0211708_101438932 | 3300020436 | Marine | MATALYPGGFKPPHRGHFEVVKKLLSGTHNGKVYN |
| Ga0211576_106605612 | 3300020438 | Marine | MIALYPGAFKPPHRGHFEVVKRLLKGNHGGHVYSIDNY |
| Ga0211518_102276551 | 3300020440 | Marine | MIALYPGAFKPPHRGHFNVVKSLLDGSYNGSIYDKDNYKDTGASLLKGRNIN |
| Ga0211547_103771082 | 3300020474 | Marine | MIALYPGAFKPPHRGHFEVVKRLLKGNHGGHVYSIDNYQD |
| Ga0213862_101428272 | 3300021347 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDGSYNGSIYDKDNYKDKGA |
| Ga0222717_104187732 | 3300021957 | Estuarine Water | MTVLYPGAFKPPHRGHFNVVKSLLDGSYNGSTYNKD |
| Ga0222713_104933022 | 3300021962 | Estuarine Water | MIALYPGAFKPPHRGHFEVVKRLLKGNHGGHIYNKD |
| Ga0212021_11090102 | 3300022068 | Aqueous | MIALYPGAFKPPHRGHFEVVKRLLNGTHKGEVYDIEDYQDAGL |
| Ga0224906_11755412 | 3300022074 | Seawater | MIALYPGAFKPPHRGHFEVVKGLLNGNHGGQVYDIENYID |
| Ga0196905_11545532 | 3300022198 | Aqueous | MIALYPGAFKPPHRGHFEVVKSLLNGTHGGKVYDVDSYTEAGASVL |
| Ga0255765_11905981 | 3300022921 | Salt Marsh | MATALYPGGFKPPHGGHFEVVKRLLNNNHNGKVYNFDDRETAGS |
| Ga0255761_103037891 | 3300023170 | Salt Marsh | MIALYPGAFKPPHRGHFEVVKRLLNGTHKGEIYDIEDYQDAGLK |
| Ga0228696_10086372 | 3300023568 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDNSYNGSVYDKDNYKETG |
| Ga0232112_10237201 | 3300023693 | Seawater | MIALYPGAFKPPHRGHFEVVRRLLNGNHGGKVYDIDSYADAGVGVLN |
| Ga0232119_10059253 | 3300023702 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDNSYNGSVYDKDNYKETGAELLKGRSNK |
| Ga0232119_10133101 | 3300023702 | Seawater | MIALYPGAYKPPHRGHYNVVKSLLDGSYNGSIYNKDNYKET |
| Ga0228633_10343892 | 3300024228 | Seawater | MIALYPGAFKPPHRGHFNVVKSLLDGSYNGAIYSKD |
| Ga0228633_10577762 | 3300024228 | Seawater | MIALYPGAFKPPHRGHFEVVKSLLNGYHGGKVYDINSYAEAGTSVLQGK |
| Ga0233402_10646232 | 3300024229 | Seawater | MIALYPGAYKPPHRGHYNVVKSLLDGSYNGSIYNKDNYKETGASLL |
| Ga0228675_10953321 | 3300024247 | Seawater | MIALYPGAYKPPHRGHYNVVKSLLDGSYNGSIYNKDNYKETGASLLGGS |
| Ga0228661_10690441 | 3300024266 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDNTYNGSIYDKD |
| Ga0233400_10866542 | 3300024318 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDNSYNGSVYDKDNYKETGAELLKGRSN |
| Ga0228672_10969201 | 3300024335 | Seawater | MIALYPGAFKPPHRGHFEVVKRLLKGNHGGHVYSI |
| Ga0244775_102230381 | 3300024346 | Estuarine | MIALYPGAFKPPHRGHFEVVKRLLKGNHGGHVYSIDNYQDVGTKALSGKKGKL |
| Ga0244775_108385752 | 3300024346 | Estuarine | MIALYPGGFKPPHRGHYEVVEKLLNGSHKGREYSIEDYQKQGTKALTKADST |
| Ga0244775_112063691 | 3300024346 | Estuarine | MIALYPGAFKPPHRGHFEVVKGLLKGNHGGHIYTKDSASDAGTKAL |
| Ga0209336_101432181 | 3300025137 | Marine | MIALYPGAYKPPHRGHFNVVKSLLDNSYNGSVYDKDNYKETGAE |
| Ga0209634_13170471 | 3300025138 | Marine | MIALYPGAFKPPHRGHFEVIRGLLNGNHGGKVYDIDSYADAGIGVLNGKGDE |
| Ga0208428_10026271 | 3300025653 | Aqueous | MATALYPGGFKPPHRGHFEVVEKLLSNTHNGKIYSFDDRED |
| Ga0208162_11966422 | 3300025674 | Aqueous | MIALYPGAFKPPHKGHFEVVKRLLNGSHGGNIYDKETGDDAGTKALAGKSGKVE |
| Ga0209657_11182341 | 3300025676 | Marine | MATALYPGAYKPPHRGHFEVVKRLLNGSHKGKVYDISNFKDIGVDALSE |
| Ga0209771_10815931 | 3300025701 | Marine | MATALYPGAFKPPHRGHFNVVKNLLNGNHKGKLYTYDDAT |
| Ga0209362_10914722 | 3300025770 | Marine | MIALYPGAYKPPHRGHFNVVKSLLDGSYSGAIYSK |
| Ga0209951_11263862 | 3300026138 | Pond Water | MIALYPGAFKPPHRGHFEVVKSLLNGTHGGQVYTKDNY |
| Ga0247599_10971553 | 3300026470 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDNSYNGSIYDKNNYKET |
| Ga0247571_10352452 | 3300026495 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDGSYNGSIYDKDNYKETGANLLKGTSNS |
| Ga0208922_10401101 | 3300027197 | Estuarine | MRSVLYSGAFKPPHRGHFEVVKRLLNNTHGGQPYDIDSHKEAGASAL |
| Ga0208133_11619921 | 3300027631 | Estuarine | MIALYPGAFKPPHRGHFEVVKSLLNGSHGGQVYSK |
| Ga0208304_101571991 | 3300027751 | Estuarine | MAVALYPGAFKPPHRGHFEVVKRLLKGTHDGKPYTLD |
| Ga0208305_101962672 | 3300027753 | Estuarine | MAVALYPGAFKPPHRGHFEVVQGLLKGNHGGHIYT |
| Ga0208671_102960572 | 3300027757 | Estuarine | MIALYPGAFKPPHRGHFEVVKRLLKGNHGGHVYSIDNYQDVGTKALSGKK |
| Ga0209711_104653162 | 3300027788 | Marine | MIALYPGAFKPPHRGHFNVIKSLLDGSYNGSIYNKDN |
| Ga0209354_104048611 | 3300027808 | Freshwater Lake | MRAVLYPGAFKPPHRGHFEVVKRLLNNTHGGHPYNI |
| Ga0209404_109834613 | 3300027906 | Marine | MIELYPGAFKPPHRGHFNVVKSLLDGTYNGAVYDKDTYKDIGPKVLK |
| Ga0228674_11129722 | 3300028008 | Seawater | MIALYPGAFKPPHRGHFNVVKSLLDGSYKGTVYNK |
| Ga0247582_10074994 | 3300028109 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDNSYNGSVYDKDNY |
| Ga0228621_10669391 | 3300028124 | Seawater | MIALYPGAFKPPHRGHFEVVKRLLKGNHGGHVYSIDNYQDVGTKALSGK |
| Ga0257114_12551591 | 3300028196 | Marine | MIALYPGAYKPPHRGHFNVVKSLLDGSYSGAIYSKDDYKEKGADL |
| Ga0228613_10129794 | 3300028279 | Seawater | MIALYPGAFKPPHRGHFEIVQRLLDGTIKGKLYGLDNY |
| Ga0233394_10950602 | 3300028391 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDGSYNGSVYNKDNYKETGAELL |
| Ga0307488_106568491 | 3300031519 | Sackhole Brine | MAIVLYPGAFKPPHRGHFELIKSLIKGNHGGVVYDIDTAQDALG |
| Ga0315322_103326732 | 3300031766 | Seawater | MATALYPGGFKPPHRGHFEVVKKLLSNTHGGKLYNFDDREEAGL |
| Ga0315322_107152471 | 3300031766 | Seawater | MIALYPGAYKPPHRGHFNVVKSLLDGSYSGAIYSKDDYKEKGAD |
| Ga0315330_103631941 | 3300032047 | Seawater | MIALYPGAFKPPHRGHFELVQSLLNGSANASVYDIDDYL |
| Ga0315321_107963831 | 3300032088 | Seawater | MIALYPGAFKPPHRGHFEVVKRLLKGNHGGHVYSIDNYQDVGTKALS |
| ⦗Top⦘ |