| Basic Information | |
|---|---|
| Family ID | F105849 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | SLLKLVKKKQANRANVVKVEEEADTDHKVVDLVKILKQSLGGKK |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.00 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (11.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 0.00% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01554 | MatE | 74.00 |
| PF14667 | Polysacc_synt_C | 7.00 |
| PF13414 | TPR_11 | 1.00 |
| PF04015 | DUF362 | 1.00 |
| PF13432 | TPR_16 | 1.00 |
| PF03795 | YCII | 1.00 |
| PF08544 | GHMP_kinases_C | 1.00 |
| PF00326 | Peptidase_S9 | 1.00 |
| PF01367 | 5_3_exonuc | 1.00 |
| PF03264 | Cytochrom_NNT | 1.00 |
| PF02739 | 5_3_exonuc_N | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 2.00 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 1.00 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.00 |
| COG3005 | Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductase | Energy production and conversion [C] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.00 % |
| Unclassified | root | N/A | 16.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000531|CNBas_1000912 | Not Available | 1463 | Open in IMG/M |
| 3300000955|JGI1027J12803_105197474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
| 3300002568|C688J35102_119695843 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300003267|soilL1_10058301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4611 | Open in IMG/M |
| 3300004114|Ga0062593_101022962 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300004157|Ga0062590_101682274 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300004479|Ga0062595_101989966 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300004479|Ga0062595_102224557 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005289|Ga0065704_10863495 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005293|Ga0065715_10932452 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005295|Ga0065707_10961325 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005331|Ga0070670_100952353 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300005331|Ga0070670_101770220 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005334|Ga0068869_100864284 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005340|Ga0070689_100533643 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300005345|Ga0070692_10662503 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005365|Ga0070688_101822138 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005458|Ga0070681_10584156 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300005518|Ga0070699_100878631 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005530|Ga0070679_101421109 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005545|Ga0070695_100642914 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005548|Ga0070665_101782943 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005577|Ga0068857_101096540 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005616|Ga0068852_101609195 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005616|Ga0068852_102807512 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005617|Ga0068859_100675743 | Not Available | 1124 | Open in IMG/M |
| 3300005718|Ga0068866_10704709 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005841|Ga0068863_100311278 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300005841|Ga0068863_100791099 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300005841|Ga0068863_102410708 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005842|Ga0068858_100427897 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300005842|Ga0068858_100552435 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005843|Ga0068860_101410870 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005875|Ga0075293_1007024 | Not Available | 1210 | Open in IMG/M |
| 3300006169|Ga0082029_1207710 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300006237|Ga0097621_101789084 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006755|Ga0079222_12424800 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006918|Ga0079216_10034964 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300006918|Ga0079216_10222699 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300006954|Ga0079219_10088378 | Not Available | 1482 | Open in IMG/M |
| 3300006954|Ga0079219_10628978 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300006969|Ga0075419_11128281 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300009094|Ga0111539_12506094 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300009101|Ga0105247_11204656 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009148|Ga0105243_11672262 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009162|Ga0075423_10706148 | Not Available | 1065 | Open in IMG/M |
| 3300009176|Ga0105242_12882812 | Not Available | 531 | Open in IMG/M |
| 3300009545|Ga0105237_10086964 | All Organisms → cellular organisms → Bacteria | 3116 | Open in IMG/M |
| 3300009553|Ga0105249_12151069 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300009553|Ga0105249_12764487 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009789|Ga0126307_11266185 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300009789|Ga0126307_11563850 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010037|Ga0126304_11203224 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010044|Ga0126310_10254499 | Not Available | 1186 | Open in IMG/M |
| 3300010045|Ga0126311_11482588 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010371|Ga0134125_12643781 | Not Available | 546 | Open in IMG/M |
| 3300010396|Ga0134126_13025464 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010399|Ga0134127_12345497 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010399|Ga0134127_13446555 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010400|Ga0134122_10978842 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010400|Ga0134122_12069387 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300011119|Ga0105246_11986133 | Not Available | 561 | Open in IMG/M |
| 3300012022|Ga0120191_10156435 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300013100|Ga0157373_11556318 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300013307|Ga0157372_12340228 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300013308|Ga0157375_13096683 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300014310|Ga0075331_1098344 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300014325|Ga0163163_10340799 | Not Available | 1554 | Open in IMG/M |
| 3300014877|Ga0180074_1062876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300014968|Ga0157379_11348694 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300015373|Ga0132257_102295544 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300018466|Ga0190268_11173675 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300018476|Ga0190274_11006981 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300025914|Ga0207671_11389484 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025921|Ga0207652_11856711 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300025923|Ga0207681_10215462 | Not Available | 1483 | Open in IMG/M |
| 3300025924|Ga0207694_10755883 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300025927|Ga0207687_10291749 | Not Available | 1311 | Open in IMG/M |
| 3300025930|Ga0207701_11012094 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300025937|Ga0207669_10547052 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300025941|Ga0207711_11352349 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300025942|Ga0207689_10218683 | Not Available | 1574 | Open in IMG/M |
| 3300025942|Ga0207689_10958537 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300025942|Ga0207689_11648230 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025960|Ga0207651_12132750 | Not Available | 503 | Open in IMG/M |
| 3300026035|Ga0207703_10088424 | All Organisms → cellular organisms → Bacteria | 2600 | Open in IMG/M |
| 3300026035|Ga0207703_10758794 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300026075|Ga0207708_10616108 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300026078|Ga0207702_11863825 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300026088|Ga0207641_10269074 | Not Available | 1598 | Open in IMG/M |
| 3300026095|Ga0207676_11779937 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300026116|Ga0207674_11790864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300027326|Ga0209731_1040447 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027637|Ga0209818_1000078 | All Organisms → cellular organisms → Bacteria | 24670 | Open in IMG/M |
| 3300027873|Ga0209814_10457384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300031548|Ga0307408_100272402 | Not Available | 1406 | Open in IMG/M |
| 3300031548|Ga0307408_102008906 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031824|Ga0307413_10067682 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300032002|Ga0307416_103338329 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300032004|Ga0307414_11042081 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.00% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| CNBas_10009121 | 3300000531 | Quercus Rhizosphere | KKKQTKRANVVKVAEEVDTDHKVIDLVQILKKSLDGKK* |
| JGI1027J12803_1051974742 | 3300000955 | Soil | LVKKKQAKPSNVVRVESKERDEGNVIDLVQILKKSLSGKSK* |
| C688J35102_1196958432 | 3300002568 | Soil | LADKQTDSLLKLVKKKEKKRENVVKVEEEVNTDRKVVDLVKILKQSLGGKK* |
| soilL1_100583013 | 3300003267 | Sugarcane Root And Bulk Soil | LKLVKKKQSKRENVVKVEDEMDTDRKVVDLVKILKQSLGGKK* |
| Ga0062593_1010229622 | 3300004114 | Soil | KQTDDLLKLVKRKEKQRGNVVRVEPEVDTDNKVIDLVEVLKKSLGAKK* |
| Ga0062590_1016822742 | 3300004157 | Soil | KLVKKKQANRANIVKVEEEADTDHKVVDLVQILKKSLGARK* |
| Ga0062595_1019899662 | 3300004479 | Soil | VKKKEKKRENVVKVEDEMDTDRKVVDLVKILKQSLGGKK* |
| Ga0062595_1022245572 | 3300004479 | Soil | VKKKQANRANIVKVEEEADTDHKVVDLVQILKKSLGAKK* |
| Ga0065704_108634952 | 3300005289 | Switchgrass Rhizosphere | LKLVKKKQANRANVVKVEEEAETDHKVVDLVKILKQSLGGKK* |
| Ga0065715_109324521 | 3300005293 | Miscanthus Rhizosphere | ADKQTDDLLKLVKRKEKQRGSVVRVEPETDSDHKVVDLVQILKKSLGAKK* |
| Ga0065707_109613251 | 3300005295 | Switchgrass Rhizosphere | VKKKQANRANVVKVEEEADTDHKVVDLVQILKKSLGAKK* |
| Ga0070670_1009523531 | 3300005331 | Switchgrass Rhizosphere | LKLVKKKQAKRSNVVKVDEEVDTDHKVVDLVSILKKSLSGKK* |
| Ga0070670_1017702201 | 3300005331 | Switchgrass Rhizosphere | KLVKKKQSKRENVVKVEEEMETDHKVVDLVKILKQSLGGKK* |
| Ga0068869_1008642842 | 3300005334 | Miscanthus Rhizosphere | KQTDSLLKLVKKKQSKRENVVKVEEEMETDHKVVDLVKILKQSLGGKK* |
| Ga0070689_1005336432 | 3300005340 | Switchgrass Rhizosphere | KQTDSLLKLVKKKQANRANVVKVEEEAETDHKVVDLVKILKQSLGGKK* |
| Ga0070692_106625031 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TESLLKLVKKKQANRANIVKVEEEADTDHKVVDLVQILKKSLGARK* |
| Ga0070688_1018221382 | 3300005365 | Switchgrass Rhizosphere | KLVKKKEKQRGNVVRVETEGESDHKVVDLVAILKKSLGAKK* |
| Ga0070681_105841562 | 3300005458 | Corn Rhizosphere | LVKKKQANRANVVKVEEDVDTDHKVVDLVQILKKSLGARK* |
| Ga0070699_1008786311 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LLKLVKKKQSKRGNVVKVEDEMESDHKVIDLVQVLKKSLGAKK* |
| Ga0070679_1014211091 | 3300005530 | Corn Rhizosphere | KLVKRKEKQRGNVVRVEPEVDTDNKVIDLVQVLKKSLGAKK* |
| Ga0070695_1006429142 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | KQTDSLLKLVKKKQSKRGNVVKVEDEMETDHKVIDLVQVLKKSLGGKK* |
| Ga0070665_1017829432 | 3300005548 | Switchgrass Rhizosphere | KKKQSKRENVVKVEEEMETDHKVVDLVKILKQSLGGKK* |
| Ga0068857_1010965402 | 3300005577 | Corn Rhizosphere | KLADKQTDSLLKLVKKKQSKRENVVKVEEEMETDHKVVDLVKILKQSLGGKK* |
| Ga0068852_1016091951 | 3300005616 | Corn Rhizosphere | SLLKLVKKKQANRANVVKVEEEADTDHKVVDLVKILKQSLGGKK* |
| Ga0068852_1028075121 | 3300005616 | Corn Rhizosphere | TDDLLKLVKKKEKKRGSVVEVETGGDSDRKVIDLVQVLKKSLAGKSS* |
| Ga0068859_1006757432 | 3300005617 | Switchgrass Rhizosphere | KKQAKRSNVVKVDEEVDTDHKVVDLVSILKKSLSGKK* |
| Ga0068866_107047091 | 3300005718 | Miscanthus Rhizosphere | DKQTDSLLKLVKKKQSKRENVVKVEEEMETDHKVVDLVKILKQSLGGKK* |
| Ga0068863_1003112782 | 3300005841 | Switchgrass Rhizosphere | DSLLKLVKKKQSKRENVVKVEEEMETDHKVVDLVKILKQSLGGKK* |
| Ga0068863_1007910991 | 3300005841 | Switchgrass Rhizosphere | TESLLKLVKKKQANRANVVKVEEEADKDHKVVDLVQILKKSLGARK* |
| Ga0068863_1024107082 | 3300005841 | Switchgrass Rhizosphere | ESLLKLVKKKQANRANVVKVEEEADTDHKVVDLVQILKKSLGAKK* |
| Ga0068858_1004278971 | 3300005842 | Switchgrass Rhizosphere | PAKLADKQTDSLLKLVKKKQSKRENVVKVEEEMDTDHKVVDLVKILKQSLGGKK* |
| Ga0068858_1005524351 | 3300005842 | Switchgrass Rhizosphere | LEDKQTDSLLKLVKKKQANRANVVKVEEEAETDHKVVDLVKILKQSLGGKK* |
| Ga0068860_1014108701 | 3300005843 | Switchgrass Rhizosphere | KLVKKKQKKRGSVVEVDVEQETDQKVVDLVSILKKSLAGKAK* |
| Ga0075293_10070241 | 3300005875 | Rice Paddy Soil | KKKEKKRENVVKVEEEVDTDRKVIDLVKILKQSLGGKK* |
| Ga0082029_12077102 | 3300006169 | Termite Nest | EDKQTDSLLKLVKKKQSKRGNVVKVEDEMETDHKVIDLVQVLKKSLGAKT* |
| Ga0097621_1017890841 | 3300006237 | Miscanthus Rhizosphere | KLVKKKQANRANVVKVAEEADTDHKVVDLVSILKKSLGARK* |
| Ga0079222_124248002 | 3300006755 | Agricultural Soil | TDELLKLVKKKEKQRGNVVRVETDEDTDHKVVDLVQILKKSLGGKK* |
| Ga0079216_100349641 | 3300006918 | Agricultural Soil | SLLKLVKQKQKKRANVVKVETEDTDHKVIDLVQILKKSLAGKGK* |
| Ga0079216_102226992 | 3300006918 | Agricultural Soil | SPTKLADKQTDDLLKLVKKKEKQRGNVVRVEAEADTDHKVIDLVQVLKRSLGGKK* |
| Ga0079219_100883781 | 3300006954 | Agricultural Soil | KKKEKKRENVVKVEDEMDTDRKVVDLVKILKQSLGGKK* |
| Ga0079219_106289782 | 3300006954 | Agricultural Soil | EDLLKLVKRKEKQRGNVVRVEQEADTDTKVIDLVQVLKKSLSAKK* |
| Ga0075419_111282811 | 3300006969 | Populus Rhizosphere | KKKQKKRGSVVEVDVEADTDHKVVDLVQILKKSLAGKAK* |
| Ga0111539_125060941 | 3300009094 | Populus Rhizosphere | KQAKASNVVKVEEEADTDHKVVDLVKILKQSLGGKK* |
| Ga0105247_112046562 | 3300009101 | Switchgrass Rhizosphere | LADKQTDSLLKLVKKKQAKRANVVKVEEEADTDHKVVDLVKILKQSLGAKK* |
| Ga0105243_116722621 | 3300009148 | Miscanthus Rhizosphere | KLVKKKKANRANVVKVEEEADPDRKVVDLVQILKKSLGAKK* |
| Ga0075423_107061481 | 3300009162 | Populus Rhizosphere | KQTDSLLKLVKKKQAKASNVVKVAEEADTDHKVVDLVKILKQSLGGKK* |
| Ga0105242_128828121 | 3300009176 | Miscanthus Rhizosphere | TKLADKQTDSLLKLVKKKEKKRENVVKVEDEVDTDRKVVDLVKILKQSLGGKK* |
| Ga0105237_100869641 | 3300009545 | Corn Rhizosphere | KQTDSLLKLVKKKQGNRANVVKVEEEADTDHKVVDLVQILKKSLGAKK* |
| Ga0105249_121510692 | 3300009553 | Switchgrass Rhizosphere | SLLKLVKKKQAKRSNVVKVEEEADTDHKVVDLVKILKQSLGAKK* |
| Ga0105249_127644871 | 3300009553 | Switchgrass Rhizosphere | KKKEKKRGSVVEVETGGDSDRKVIDLVQVLKKSLAGKSS* |
| Ga0126307_112661852 | 3300009789 | Serpentine Soil | LKLVKKKQSKRENVVKVAEEMDTDHKVIDLVQVLKKSLGGKK* |
| Ga0126307_115638502 | 3300009789 | Serpentine Soil | SLLKLVKKKQAKSSNVVKVDEEVDTDNKVVDLVSILKKSLSGKK* |
| Ga0126304_112032242 | 3300010037 | Serpentine Soil | DKQTDSLLKLVKKKQTKRENVVKVEDEMETDRKVVDLVKILKQSLGGKK* |
| Ga0126310_102544991 | 3300010044 | Serpentine Soil | TDSLLKLVKKKQTKRENVVKVEDEMETDRKVVDLVKILKQSLGGK* |
| Ga0126311_114825881 | 3300010045 | Serpentine Soil | PTKLADKQTDSLLKLVKKKQSKRGAVVRVEEEAETDHKVVDLVQILKKSLGGKK* |
| Ga0134125_126437811 | 3300010371 | Terrestrial Soil | LVKKKQSKRGNVVKVEDEMETDHKVIDLVQVLKKSLGAKS* |
| Ga0134126_130254641 | 3300010396 | Terrestrial Soil | DELLKLVKRKEKQRGNVVRVEPEADTDNKVVDLVQILKKSLAGKK* |
| Ga0134127_123454971 | 3300010399 | Terrestrial Soil | DKQTESLLKLVKKKQANRANIVKVEEEADADHKVVDLVQILKKSLGARK* |
| Ga0134127_134465551 | 3300010399 | Terrestrial Soil | KKQAKRANVVKVEEEADTDHKVVDLVKILKQSLGAKK* |
| Ga0134122_109788422 | 3300010400 | Terrestrial Soil | LEDKQTESLLKLVKKKQANRANIVKVEEEADADHKVVDLVQILKKSLGARK* |
| Ga0134122_120693871 | 3300010400 | Terrestrial Soil | LLKLVKKKKANRANVVKVEEEADTDHKVVDLVQILKKSLGARK* |
| Ga0105246_119861331 | 3300011119 | Miscanthus Rhizosphere | LADKQTDSLLKLVKKKQAKRANVVKVEEEIDTDHKVVDLVKILKQSLGAKK* |
| Ga0120191_101564352 | 3300012022 | Terrestrial | KLVKKKQAKRANVVRVEEEVDTDHKVIDLVQILKKSLSGKAK* |
| Ga0157373_115563181 | 3300013100 | Corn Rhizosphere | DSLLKLVKKKEKKRENVVKVEEEVDTDRKVVDLVKILKQSLGGKK* |
| Ga0157372_123402281 | 3300013307 | Corn Rhizosphere | TTLADKQTDSLLKLVKKKEKKRENVVKVEDEMDTDRKVVDLVKILKQSLGGKK* |
| Ga0157375_130966831 | 3300013308 | Miscanthus Rhizosphere | DKQTDSLLKLVKKKQAKRSNVVKVEEEADTDHKVVDLVKILKQSLGGKK* |
| Ga0075331_10983442 | 3300014310 | Natural And Restored Wetlands | LKLVKKKQSKRGAVVKVKEEMDTNHKVVDLVQILKKSLGGKK* |
| Ga0163163_103407991 | 3300014325 | Switchgrass Rhizosphere | KQTDSLLKLVKKKQAKRSNVVKVEEEADTDHKVVDLVKILKQSLGAKK* |
| Ga0180074_10628761 | 3300014877 | Soil | KRKQAKRSNVVRVESEERDEGKVIDLVQILKKSLSGKSN* |
| Ga0157379_113486942 | 3300014968 | Switchgrass Rhizosphere | LKLVKKKQSKRENVVKVEEEMETDHKVVDLVKILKQSLGGKK* |
| Ga0132257_1022955441 | 3300015373 | Arabidopsis Rhizosphere | QANRANVVKVEEEADTDHKVVDLVKILKQSLGGKK* |
| Ga0190268_111736752 | 3300018466 | Soil | SPSKELADKQTDDLLKLVKKKEKKRSNVVEVETETADHKVIDLVQVLKKSLAGKSK |
| Ga0190274_110069811 | 3300018476 | Soil | PAKLADKQTDSLLKLVKKKQANRANVVKVEEEADTDHKVVDLIQILKKSLGARK |
| Ga0207671_113894841 | 3300025914 | Corn Rhizosphere | FTPAKLADKQTDSLLKLVKKKQSKRENVVKVEEEMDTDHKVVDLVKILKQSLGGKK |
| Ga0207652_118567111 | 3300025921 | Corn Rhizosphere | KLVKRKEKQRGNVVRVEPEVDTDNKVIDLVQVLKKSLGAKK |
| Ga0207681_102154622 | 3300025923 | Switchgrass Rhizosphere | KLVKKKEKKRGSVVEVETGGDSDRKVIDLVQVLKKSLAGKSS |
| Ga0207694_107558831 | 3300025924 | Corn Rhizosphere | SLLKLVKKKQSKRENVVKVEEEIDTDHKVVDLVKILKQSLGGKK |
| Ga0207687_102917492 | 3300025927 | Miscanthus Rhizosphere | LLKLVKKKEKKRENVVKVEEEIDTDRKVVDLVKILKQSLGGKK |
| Ga0207701_110120941 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VKKKEKKRENVVKVEDEMDTDRKVVDLVKILKQSLGGKK |
| Ga0207669_105470521 | 3300025937 | Miscanthus Rhizosphere | KLVKKKQSKRENVVKVEEEMDTDHKVVDLVKILKQSLGGKK |
| Ga0207711_113523492 | 3300025941 | Switchgrass Rhizosphere | KKKQSKRENVVKVEEEMDTDHKVVDLVKILKQSLGGKK |
| Ga0207689_102186831 | 3300025942 | Miscanthus Rhizosphere | KQAKRSNVVKVEEEVDTDHKVVDLVSILKKSLSGKK |
| Ga0207689_109585372 | 3300025942 | Miscanthus Rhizosphere | TKLADKQSDSLLKLVKKKEKKRENVVKVEEEVDTDRKVVDLVKILKQSLGWKK |
| Ga0207689_116482302 | 3300025942 | Miscanthus Rhizosphere | FTPTKLADKQTDSLLKLVKKKQAKRANVVKVEEEIDTDHKVVDLVKILKQSLGAKK |
| Ga0207651_121327501 | 3300025960 | Switchgrass Rhizosphere | DSLLKLVKKKEKKRENVVKVEDEVDTDRKVVDLVKILKQSLGGKK |
| Ga0207703_100884241 | 3300026035 | Switchgrass Rhizosphere | TKLADKQTDSLLKLVKKKQAKRSNVVKVEEEADTDHKVVDLVKILKQSLGGKK |
| Ga0207703_107587941 | 3300026035 | Switchgrass Rhizosphere | SLLKLVKKKQANRANVVKVEEEAETDHKVVDLVKILKQSLGGKK |
| Ga0207708_106161081 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | DKQTDSLLKLVKKKQSKRENVVKVEEAMETDHKVVDLVKILKQSLGGKK |
| Ga0207702_118638251 | 3300026078 | Corn Rhizosphere | SLLKLVKKKQGNRANVVKVEEEADTDHKVVDLVQILKKSLGAKK |
| Ga0207641_102690741 | 3300026088 | Switchgrass Rhizosphere | KKKQAKRSNVVKVDEEVDTDHKVVDLVSILKKSLSGKK |
| Ga0207676_117799372 | 3300026095 | Switchgrass Rhizosphere | MQSKKKQSKRENVVKVEEEMDTDHKVVDLVKILKQSLGGKK |
| Ga0207674_117908641 | 3300026116 | Corn Rhizosphere | TKLADKQTDSLLKLVKKKQAKRSNVVKVDEEVDTDHKVVDLVSILKKSLSGKK |
| Ga0209731_10404471 | 3300027326 | Forest Soil | LVKKKQAKRSNIVKVEEEVDTDHKVVDLVKILKQSLGGKK |
| Ga0209818_100007826 | 3300027637 | Agricultural Soil | VKQKQKKRANVVKVETEDTDHKVIDLVQILKKSLAGKGK |
| Ga0209814_104573843 | 3300027873 | Populus Rhizosphere | LKLVKKKQAKASNVVKVEEEADTDHKVVDLVKILKQSLGGKK |
| Ga0307408_1002724022 | 3300031548 | Rhizosphere | KLADKQTDSLLKLVKKKQAKRSNVVKVDEEVDTDHKVVDLVSILKKSLSGKK |
| Ga0307408_1020089062 | 3300031548 | Rhizosphere | ADKQTDELLKLVKQKQKKRSNVVEVDVEADTDHKVVDLVQILKKSLAGKAK |
| Ga0307413_100676823 | 3300031824 | Rhizosphere | DKQTESLLKLVKKKQANRANVVKVEEEADTDHKVVDLVQILKKSLGAKK |
| Ga0307416_1033383291 | 3300032002 | Rhizosphere | TDDLLKLVKRKEKQRGNVVRVEPEADTDHKVVDLVQILKKSLGGKK |
| Ga0307414_110420812 | 3300032004 | Rhizosphere | TDSLLKLVKKKQSKRANVVRVEEEATDHKVIDLVQVLKKSLGGKK |
| ⦗Top⦘ |