| Basic Information | |
|---|---|
| Family ID | F105848 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | QGHPVKVTGLVAQPWTMADRSGVAFRAARVEPVVAQAKAS |
| Number of Associated Samples | 60 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.00 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (27.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.35% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01580 | FtsK_SpoIIIE | 2.00 |
| PF02371 | Transposase_20 | 2.00 |
| PF00842 | Ala_racemase_C | 1.00 |
| PF13751 | DDE_Tnp_1_6 | 1.00 |
| PF13358 | DDE_3 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1674 | DNA segregation ATPase FtsK/SpoIIIE or related protein | Cell cycle control, cell division, chromosome partitioning [D] | 2.00 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.00 |
| COG0787 | Alanine racemase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.00 % |
| Unclassified | root | N/A | 28.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100519618 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300003373|JGI25407J50210_10087322 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005562|Ga0058697_10317010 | Not Available | 749 | Open in IMG/M |
| 3300006058|Ga0075432_10013344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2792 | Open in IMG/M |
| 3300006169|Ga0082029_1209420 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300006581|Ga0074048_12054518 | Not Available | 500 | Open in IMG/M |
| 3300006642|Ga0075521_10265954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300006845|Ga0075421_101408941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300006845|Ga0075421_101925801 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006845|Ga0075421_102746478 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006847|Ga0075431_100297256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1632 | Open in IMG/M |
| 3300006871|Ga0075434_102141087 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006880|Ga0075429_101147301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
| 3300006880|Ga0075429_102007717 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006969|Ga0075419_10677096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 730 | Open in IMG/M |
| 3300006969|Ga0075419_11532482 | Not Available | 501 | Open in IMG/M |
| 3300009100|Ga0075418_11809212 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300009147|Ga0114129_10994510 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300009147|Ga0114129_11296285 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300009147|Ga0114129_11941384 | Not Available | 713 | Open in IMG/M |
| 3300009147|Ga0114129_12804428 | Not Available | 579 | Open in IMG/M |
| 3300009156|Ga0111538_12526970 | Not Available | 644 | Open in IMG/M |
| 3300009162|Ga0075423_11131420 | Not Available | 834 | Open in IMG/M |
| 3300009789|Ga0126307_10276689 | Not Available | 1350 | Open in IMG/M |
| 3300009789|Ga0126307_10628263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 867 | Open in IMG/M |
| 3300009789|Ga0126307_10659389 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300009789|Ga0126307_11499310 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009810|Ga0105088_1062634 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009813|Ga0105057_1005012 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300009820|Ga0105085_1080870 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009837|Ga0105058_1018712 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300009840|Ga0126313_10059664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2717 | Open in IMG/M |
| 3300009840|Ga0126313_10661881 | Not Available | 844 | Open in IMG/M |
| 3300009840|Ga0126313_10810542 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300009840|Ga0126313_10971907 | Not Available | 695 | Open in IMG/M |
| 3300010036|Ga0126305_10191705 | Not Available | 1292 | Open in IMG/M |
| 3300010036|Ga0126305_11217621 | Not Available | 520 | Open in IMG/M |
| 3300010038|Ga0126315_11040967 | Not Available | 550 | Open in IMG/M |
| 3300010041|Ga0126312_10727551 | Not Available | 717 | Open in IMG/M |
| 3300010041|Ga0126312_11020310 | Not Available | 606 | Open in IMG/M |
| 3300010042|Ga0126314_10343372 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300010042|Ga0126314_10402739 | Not Available | 986 | Open in IMG/M |
| 3300010042|Ga0126314_10732862 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300010042|Ga0126314_10786390 | Not Available | 700 | Open in IMG/M |
| 3300010042|Ga0126314_11374793 | Not Available | 530 | Open in IMG/M |
| 3300010044|Ga0126310_10170771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1404 | Open in IMG/M |
| 3300010044|Ga0126310_10178620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1377 | Open in IMG/M |
| 3300010045|Ga0126311_10290850 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300010045|Ga0126311_10858627 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010045|Ga0126311_11029194 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010166|Ga0126306_10250866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1350 | Open in IMG/M |
| 3300010166|Ga0126306_10613075 | Not Available | 868 | Open in IMG/M |
| 3300010166|Ga0126306_11413480 | Not Available | 576 | Open in IMG/M |
| 3300010166|Ga0126306_11461333 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012904|Ga0157282_10248286 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300012941|Ga0162652_100024168 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300014487|Ga0182000_10522066 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300019377|Ga0190264_11704280 | Not Available | 561 | Open in IMG/M |
| 3300019767|Ga0190267_10790764 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300022534|Ga0224452_1012650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2239 | Open in IMG/M |
| 3300022756|Ga0222622_10331856 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300027018|Ga0208475_1014039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 782 | Open in IMG/M |
| 3300027511|Ga0209843_1040244 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300027718|Ga0209795_10230199 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300028707|Ga0307291_1211564 | Not Available | 502 | Open in IMG/M |
| 3300028713|Ga0307303_10084620 | Not Available | 712 | Open in IMG/M |
| 3300028771|Ga0307320_10224480 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300028796|Ga0307287_10369441 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300028811|Ga0307292_10219714 | Not Available | 784 | Open in IMG/M |
| 3300028811|Ga0307292_10244559 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300028814|Ga0307302_10255651 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300028819|Ga0307296_10106662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1503 | Open in IMG/M |
| 3300028828|Ga0307312_10026454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3352 | Open in IMG/M |
| 3300028878|Ga0307278_10093452 | Not Available | 1353 | Open in IMG/M |
| 3300028881|Ga0307277_10230567 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300030336|Ga0247826_11260668 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031548|Ga0307408_100486863 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300031731|Ga0307405_10124520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1770 | Open in IMG/M |
| 3300031731|Ga0307405_10132238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1726 | Open in IMG/M |
| 3300031731|Ga0307405_10386348 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300031731|Ga0307405_10737807 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031824|Ga0307413_10119206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1783 | Open in IMG/M |
| 3300031824|Ga0307413_10238821 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300031901|Ga0307406_10084721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2117 | Open in IMG/M |
| 3300031901|Ga0307406_10798716 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300031901|Ga0307406_12025213 | Not Available | 515 | Open in IMG/M |
| 3300031903|Ga0307407_10058407 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300031903|Ga0307407_10455478 | Not Available | 929 | Open in IMG/M |
| 3300031903|Ga0307407_10566835 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300031903|Ga0307407_10603414 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031903|Ga0307407_10939861 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300031911|Ga0307412_10744018 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031995|Ga0307409_100252861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1612 | Open in IMG/M |
| 3300031995|Ga0307409_101675473 | Not Available | 664 | Open in IMG/M |
| 3300032005|Ga0307411_10623760 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300032005|Ga0307411_12100148 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300032126|Ga0307415_100385097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300032126|Ga0307415_101896247 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300032126|Ga0307415_102308590 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032159|Ga0268251_10244352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 27.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 23.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.00% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 3.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1005196181 | 3300000956 | Soil | VPGMPSQAIRQGHPVKVVGLVAQPWVMADRSGVSFRAARIEPVVSAAKAS* |
| JGI25407J50210_100873223 | 3300003373 | Tabebuia Heterophylla Rhizosphere | QGHPVKVTGLVAQPWSMNDRSGVAFRAVRIEPAVVQAKAS* |
| Ga0058697_103170101 | 3300005562 | Agave | HPVKVTGLVAQPWSMNDRSGVAFRAARIEPVVAQAKAS* |
| Ga0075432_100133445 | 3300006058 | Populus Rhizosphere | RQGHPVKVTGLVAQPWTMNDRAGVAFRAARVEPVVAQAKAS* |
| Ga0082029_12094203 | 3300006169 | Termite Nest | LRQGHPVKVHGLVAQPWTMQDRSGVAFRAAQIEPAIPQAKAS* |
| Ga0074048_120545181 | 3300006581 | Soil | GHPVKVTGLVAQPWSMNDRAGVAFRAARIEPVVAQAKAS* |
| Ga0075521_102659543 | 3300006642 | Arctic Peat Soil | PVKVAGLTANFWSMNDRSGLSFRAAKVEPVGAPVRVAS* |
| Ga0075421_1014089412 | 3300006845 | Populus Rhizosphere | MPSAAIRQGHPVKVTGLVAQPWTMQDRSGVSFRAARIEPAMAAAKAS* |
| Ga0075421_1019258011 | 3300006845 | Populus Rhizosphere | VRQGAPVKVSGLVAQPWTMADRSGVSFRAARVEPAVAAAKAS* |
| Ga0075421_1027464782 | 3300006845 | Populus Rhizosphere | GHPVKVTGLVAQPWTMADRSGVSFRAARVEPAIAQAKAS* |
| Ga0075431_1002972563 | 3300006847 | Populus Rhizosphere | AIRQGAPVKVTGLVAQPWTMADRSGVSFKAAGVEPAITQAKAS* |
| Ga0075434_1021410871 | 3300006871 | Populus Rhizosphere | QGHPVKVTGLVAQPWSMNDRSGVAFRAARVEPVVAQAKAS* |
| Ga0075429_1011473012 | 3300006880 | Populus Rhizosphere | IRQGAPVKVTGLVAQPWTMQDRSGVSFRAARIEPAMAAAKAS* |
| Ga0075429_1020077172 | 3300006880 | Populus Rhizosphere | AIRQGAPVKVTGLVAQPWTMADRSGVSFRAARIEPAMAAAKAS* |
| Ga0075419_106770961 | 3300006969 | Populus Rhizosphere | VKVTGLVAQPWSMNDRSGVAFRAARIEPVVAQAKAS* |
| Ga0075419_115324822 | 3300006969 | Populus Rhizosphere | VKVSGLVAQPWTMADRSGVAFRAARLEPAVPQPQAKAS* |
| Ga0075418_118092122 | 3300009100 | Populus Rhizosphere | SSAIRQGAPVKVAGLVAQPWTMNDRSGVSFRAARIEPAIAQAKAS* |
| Ga0114129_109945101 | 3300009147 | Populus Rhizosphere | HPVKVTGLVAQPWTMNDRAGVAFRAARIEPVVAQAKAS* |
| Ga0114129_112962854 | 3300009147 | Populus Rhizosphere | PGVPSPAIRQGIPVKVHGLVAQPWTMADRSGVSFRAARVEPAVAAAKAS* |
| Ga0114129_119413841 | 3300009147 | Populus Rhizosphere | KVTGLVAQPWSMNDRSGVAFRAARIEPAIPAAKAS* |
| Ga0114129_128044281 | 3300009147 | Populus Rhizosphere | VLGLVAQPWTMGERAGVAFRAQRIEPIAAQQARAS* |
| Ga0111538_125269702 | 3300009156 | Populus Rhizosphere | AIRQGHPVRVHGLVAQPWTMADRSGVAFRAARIESAVPAAKAS* |
| Ga0075423_111314201 | 3300009162 | Populus Rhizosphere | PVRVHGLVAQPWTMADRSGVAFRAARIESAVPAAKAS* |
| Ga0126307_102766891 | 3300009789 | Serpentine Soil | KVTGLVAQPWTMADRSGVSFRAARVEPAIAQAKAS* |
| Ga0126307_106282631 | 3300009789 | Serpentine Soil | PVKVHGLVAQPWSMNDRAGVAFRAARVEPVMAQAKAS* |
| Ga0126307_106593893 | 3300009789 | Serpentine Soil | VHGLVAQPWSMNDRAGVAFRAARIEPAVAQAKAS* |
| Ga0126307_114993102 | 3300009789 | Serpentine Soil | PSPAIRQGHPVKVTGLVAQPWTMNDRSGVSFRAARVEPVMAQAKAS* |
| Ga0105088_10626343 | 3300009810 | Groundwater Sand | VKVTGLVAQPWTMNDRSGVAFRAARIEPAVPQAKAS* |
| Ga0105057_10050122 | 3300009813 | Groundwater Sand | GIRQGHPVKMHGLVAQPWTMNDRSGVSFRAARVEPAMAAAKAS* |
| Ga0105085_10808702 | 3300009820 | Groundwater Sand | PSQAIRQGHPVKVVGLVAQPWTMADRSGVAFRAARIEPAVSAAKAS* |
| Ga0105058_10187123 | 3300009837 | Groundwater Sand | PVKVVGLVAQPWTMGDRSGVAFRAARVEPVMAQAKAS* |
| Ga0126313_100596641 | 3300009840 | Serpentine Soil | VKVHGLVAQPWTMNDRAGVAFRAARVEPAVPAAKAS* |
| Ga0126313_106618812 | 3300009840 | Serpentine Soil | RQGHPVKVTGLVAQPWPMNDCSGVAFRAARIEPAVPQAKAS* |
| Ga0126313_108105423 | 3300009840 | Serpentine Soil | AAVKVVGLVAQPWTMNDRSGVSFRAVRIEPAMAAAKAS* |
| Ga0126313_109719071 | 3300009840 | Serpentine Soil | HPVKVHGLVAQPWSMNDRAGVAFRAARVEPVVTQAKAS* |
| Ga0126305_101917051 | 3300010036 | Serpentine Soil | HPVKVHGLVAQPWSMNDRSGVAFRAARIEPVVAQAKAS* |
| Ga0126305_112176211 | 3300010036 | Serpentine Soil | PVRVIDLVANPWSNNGKSGVAFRAVRIEPAQGKAS* |
| Ga0126315_110409674 | 3300010038 | Serpentine Soil | VRVIDLVANPWSNNGKSGVAFRAVRIEPAQGKAS* |
| Ga0126312_107275511 | 3300010041 | Serpentine Soil | PVKVHGLVAQPWTMNDRAGVAFRAARIEPVVAQAKAS* |
| Ga0126312_110203101 | 3300010041 | Serpentine Soil | GMPSPAIRQGHPVKVTGLVAQPWPMNDCSGVAFRAARIEPAVPQAKAS* |
| Ga0126314_103433721 | 3300010042 | Serpentine Soil | IRQGHPVKVHGLVAQPWTMNDRSGVAFRAARVEPVVAQAKAS* |
| Ga0126314_104027391 | 3300010042 | Serpentine Soil | ALVRHPPGRPVKVTGLVAQPWTMADRSGVSFKAARVEPAIAQAKAS* |
| Ga0126314_107328623 | 3300010042 | Serpentine Soil | QGHPVKVSGLVAQPWTMQDRSGVAFRAARIEPAVPQAQAKAS* |
| Ga0126314_107863901 | 3300010042 | Serpentine Soil | HPVKVTGLVAQPWSMNDRAGVAFRAARVEPVVAQAKAS* |
| Ga0126314_113747931 | 3300010042 | Serpentine Soil | LIAVKIPGVPSSAIRQGAPVKVTGLVAQPWMADRSGVSFRAVRIEPAMAAAKAS* |
| Ga0126310_101707711 | 3300010044 | Serpentine Soil | SQGIRQGAPVKVSGLVAQPWTMADRSGVSFRAQRVEPAIAAAKAS* |
| Ga0126310_101786201 | 3300010044 | Serpentine Soil | RQGHPVKVTGLVAQPWSMNDRAGVAFRAARVEPVVAQAKAS* |
| Ga0126311_102908501 | 3300010045 | Serpentine Soil | QGIPVKVTGLVAQPWTMADRSGVSFRAARVEPAIAQAKAS* |
| Ga0126311_108586271 | 3300010045 | Serpentine Soil | QGHPVKVTGLVAQPWTMADRSGVAFRAARVEPVVAQAKAS* |
| Ga0126311_110291941 | 3300010045 | Serpentine Soil | QGHPVKVHGLVAQPWTMNDRAGVAFRAARIEPAVPAAKAS* |
| Ga0126306_102508663 | 3300010166 | Serpentine Soil | VSGLVAQPWSMNDRAGVAFRAARIEPAVPAAKAS* |
| Ga0126306_106130751 | 3300010166 | Serpentine Soil | PVKVTGLVAQPWTMQDRSGVSFRAARVEPAITQAKAS* |
| Ga0126306_114134802 | 3300010166 | Serpentine Soil | VHGLVAQPWSMNDRSGVAFRATRIEPAVPAAKAS* |
| Ga0126306_114613331 | 3300010166 | Serpentine Soil | QGAPVKVTGLVAQPWTMNDRSGVSFRAARVEPAMAAAKAS* |
| Ga0157282_102482861 | 3300012904 | Soil | PVKVHGLVAQPWTMNDRSGVAFRAARVEPVVAQAKAS* |
| Ga0162652_1000241683 | 3300012941 | Soil | RQGHPVKVTGLVAQPWTMNDRAGVAFRAARIEPAVPQAKAS* |
| Ga0182000_105220662 | 3300014487 | Soil | PGVPSSAIRQGAPVKVTGLVAQPWTMADRSGVSFRAQRVEPAMAAAKAS* |
| Ga0190264_117042802 | 3300019377 | Soil | VKVTGLVAQPWSMNDPAGVAFRAARIEPVVAQAKAS |
| Ga0190267_107907641 | 3300019767 | Soil | MPSGIRQGHPVKVHGLVAQPWTMNDRAGVAFRAARIEPAVPAAKAS |
| Ga0224452_10126505 | 3300022534 | Groundwater Sediment | LIALKVPGVPSQAIRQGAPVKVVGLVAQPWTMNERSGVSFRAASVEPAIVQAKAN |
| Ga0222622_103318561 | 3300022756 | Groundwater Sediment | GTPSQAIRQGHPVKVTGLVAQPWTMNDRSGVAFRAARVEPAVPQAKAS |
| Ga0208475_10140391 | 3300027018 | Soil | VKVHGLVAQPWSMNDRAGVAFRAARVEPAVPQAKAS |
| Ga0209843_10402443 | 3300027511 | Groundwater Sand | RQGHPVKVVGLVAQPWTMADRSGVSFRAARIEPAVSAAKAS |
| Ga0209795_102301992 | 3300027718 | Agave | GAPVKVSGLVAQPWTMADRSGVSFRAARVEPAVAAAKAS |
| Ga0307291_12115641 | 3300028707 | Soil | PVKVHGLVAQPWTMNDRSGVAFRAARVEWVMAQAKAS |
| Ga0307303_100846202 | 3300028713 | Soil | KVHGLVAQPWSMNDRSGVAFRAARVEPAVPAAKAS |
| Ga0307320_102244801 | 3300028771 | Soil | KVTGLVAQPWTMNDRSGVAFRAARVEPAVAQAKAS |
| Ga0307287_103694412 | 3300028796 | Soil | GLRQGHPVKVTGLVAQPWTMNDRSGVAFRAARVEPVVAQAKAS |
| Ga0307292_102197144 | 3300028811 | Soil | VKVTGLVAQPWTMADRSGVSFKAARVEPVVAQAKAKAKAKAS |
| Ga0307292_102445591 | 3300028811 | Soil | QGHPVKVTGLVAQPWTMNDRAGVAFRAARVEPVVAQAKAS |
| Ga0307302_102556513 | 3300028814 | Soil | GVPVKVHGLVAQPWTMADRSGVSFRAARVEPAMAAAKAS |
| Ga0307296_101066624 | 3300028819 | Soil | PVKVTGLVAQPWTMNDRSGVAFRAARVEPVVAQAKAS |
| Ga0307312_100264544 | 3300028828 | Soil | PVKVTGLVAQPWTMQDRSGVSFRAARIEPAMAAAKAS |
| Ga0307278_100934521 | 3300028878 | Soil | APVKVVGLVAQPWTMNDRSGVSFRAASVEPAIVQAKAS |
| Ga0307277_102305671 | 3300028881 | Soil | PVKVTGLVAQPWTMNDRAGVAFRAARIEPAVAQAKAS |
| Ga0247826_112606683 | 3300030336 | Soil | GLRQGHPVKVTGLVAQPWTMNDRAGVAFRAARVEPVVAQAKAS |
| Ga0307408_1004868631 | 3300031548 | Rhizosphere | SGLRQGHPVKVHGLVAQPWTMADRSGVAFRAARIEPAVPQAHAKAS |
| Ga0307405_101245203 | 3300031731 | Rhizosphere | PVKVSGLVAQPWTMADRSGVSFRAQRVEPAMAAAKAS |
| Ga0307405_101322384 | 3300031731 | Rhizosphere | IRQGHPVKVHGLVAQPWSMNDRAGVAFRAARIEPVVAQAKAS |
| Ga0307405_103863481 | 3300031731 | Rhizosphere | RQGHPVKVTGLVAQPWTMNDRAGVAFRAARIEPAVPAAKAS |
| Ga0307405_107378071 | 3300031731 | Rhizosphere | VKVTGLVAQPWTMNDRSGVAFRAARIEPAVPQAKAS |
| Ga0307413_101192061 | 3300031824 | Rhizosphere | QGHPVKVTGLVAQPWTMNDRAGVAFRAARVEPAVPQAKAS |
| Ga0307413_102388211 | 3300031824 | Rhizosphere | SQAIQQGVPVKVSGLVAQPWTMNDRSGVAFRAARVEPVVAQAKAS |
| Ga0307406_100847214 | 3300031901 | Rhizosphere | AAIRQGVPVKVTGLVAQPWTMADRSGVSFRAARVEPAIAQAKAS |
| Ga0307406_107987161 | 3300031901 | Rhizosphere | AVKVAGLVAQPWTMNDRSGVSFRAARIEPAIAQAKAS |
| Ga0307406_120252131 | 3300031901 | Rhizosphere | PVKVHGLVAQPWSMNDRAGVAFRAARIEPAVSQAKAS |
| Ga0307407_100584074 | 3300031903 | Rhizosphere | DLLAVKVSGVPSQAIRQGVPVKVSGLVAQPWTMNDRAGVSFRAATVERVVAAAKAS |
| Ga0307407_104554784 | 3300031903 | Rhizosphere | PQGTPVRVIDLVANPWSNNGKSGVAFRAVRIESAQGKAS |
| Ga0307407_105668354 | 3300031903 | Rhizosphere | AIRQGAPVKVTGLVAQPWTMADRSGVSFRAARVEPAVAAAKAS |
| Ga0307407_106034141 | 3300031903 | Rhizosphere | GVPAPAIRQGAPVKVSGLVAQPWTMADRSGVSFRAQRVEPAMAAAKAS |
| Ga0307407_109398611 | 3300031903 | Rhizosphere | SAIRQGAPVKVSGLVAQPWTMADRSGVSFRAQRVEPAMAAAKAS |
| Ga0307412_107440183 | 3300031911 | Rhizosphere | RQGHPVKVHGLVAQPWTMNDRSGVAFRAARVESAVPQAKAS |
| Ga0307409_1002528615 | 3300031995 | Rhizosphere | SQAIRQGHPVKVHGLVAQPWSMNDRAGVAFRAARVEPVVTQAKAS |
| Ga0307409_1016754731 | 3300031995 | Rhizosphere | EVTGLVAQPWSMNDRAGVAFRAARIEPAVSAAKAS |
| Ga0307411_106237603 | 3300032005 | Rhizosphere | GHPVKVSGLVAQPWTMQDRSGVAFRAARIEPAVPQAQAKAS |
| Ga0307411_121001482 | 3300032005 | Rhizosphere | VKVTGLVAQPWTMADRSGVSFRAARIEPAIAQAKAS |
| Ga0307415_1003850973 | 3300032126 | Rhizosphere | GLRQGHPVKVVGLVAQPWTMGDRSGVAFRAARIEPAMAAAKAS |
| Ga0307415_1018962472 | 3300032126 | Rhizosphere | IRQGAPVKVSGLVAQPWTMADRSGVSFRAQRVEPAMAAAKAS |
| Ga0307415_1023085902 | 3300032126 | Rhizosphere | ASQAIRQGHPVKVVGLVAQPWTMADRSGVAFRAARIEPAVAAAKAS |
| Ga0268251_102443521 | 3300032159 | Agave | VPSAGIRQGAPVKVSGLVAQPWTMADRSGVSFRAARIEPAMATAKAS |
| ⦗Top⦘ |