| Basic Information | |
|---|---|
| Family ID | F105846 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MTAEEHSSSAGRPELDLDEERDDGKDDGAPVAGGLCRLDAPDSAADEDAG |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.00 % |
| % of genes near scaffold ends (potentially truncated) | 28.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.00 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF05977 | MFS_3 | 25.00 |
| PF01625 | PMSR | 16.00 |
| PF07690 | MFS_1 | 10.00 |
| PF07883 | Cupin_2 | 2.00 |
| PF03190 | Thioredox_DsbH | 1.00 |
| PF07498 | Rho_N | 1.00 |
| PF03176 | MMPL | 1.00 |
| PF01583 | APS_kinase | 1.00 |
| PF02543 | Carbam_trans_N | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 25.00 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 16.00 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 1.00 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.00 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 1.00 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 1.00 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.00 % |
| Unclassified | root | N/A | 2.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10022064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4291 | Open in IMG/M |
| 3300003324|soilH2_10127414 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300003993|Ga0055468_10153174 | Not Available | 687 | Open in IMG/M |
| 3300003998|Ga0055472_10016309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1554 | Open in IMG/M |
| 3300003998|Ga0055472_10224313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300004081|Ga0063454_100123098 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300004114|Ga0062593_100021925 | All Organisms → cellular organisms → Bacteria | 3403 | Open in IMG/M |
| 3300004114|Ga0062593_100115094 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300004114|Ga0062593_100275601 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300004157|Ga0062590_101861540 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300004157|Ga0062590_102001307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300004463|Ga0063356_100194748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2381 | Open in IMG/M |
| 3300004479|Ga0062595_100436510 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300004480|Ga0062592_100898108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
| 3300004480|Ga0062592_102420781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300004480|Ga0062592_102551365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300004643|Ga0062591_100366270 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300005093|Ga0062594_103145502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300005294|Ga0065705_10212056 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300005327|Ga0070658_10148720 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300005329|Ga0070683_100631993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1025 | Open in IMG/M |
| 3300005331|Ga0070670_102113198 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005332|Ga0066388_101493859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1181 | Open in IMG/M |
| 3300005340|Ga0070689_100731655 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005438|Ga0070701_10725390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300005440|Ga0070705_100555271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 881 | Open in IMG/M |
| 3300005456|Ga0070678_100902939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300005459|Ga0068867_101315658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300005471|Ga0070698_100978547 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005547|Ga0070693_100594035 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005614|Ga0068856_100192237 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
| 3300005616|Ga0068852_100633489 | Not Available | 1076 | Open in IMG/M |
| 3300005874|Ga0075288_1015517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1045 | Open in IMG/M |
| 3300005937|Ga0081455_10033149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4645 | Open in IMG/M |
| 3300006169|Ga0082029_1250291 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300006196|Ga0075422_10117718 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300006881|Ga0068865_100139896 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300009094|Ga0111539_10016055 | All Organisms → cellular organisms → Bacteria | 9293 | Open in IMG/M |
| 3300009545|Ga0105237_10543847 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300009553|Ga0105249_10862632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 971 | Open in IMG/M |
| 3300009789|Ga0126307_10000405 | All Organisms → cellular organisms → Bacteria | 27927 | Open in IMG/M |
| 3300009840|Ga0126313_10412230 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300010036|Ga0126305_10286197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1067 | Open in IMG/M |
| 3300010038|Ga0126315_11098468 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010041|Ga0126312_10188145 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300010042|Ga0126314_10067200 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300010373|Ga0134128_10092309 | All Organisms → cellular organisms → Bacteria | 3445 | Open in IMG/M |
| 3300010397|Ga0134124_12485626 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010400|Ga0134122_10584120 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300012212|Ga0150985_116838300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 897 | Open in IMG/M |
| 3300012891|Ga0157305_10107923 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012899|Ga0157299_10022277 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300012899|Ga0157299_10055222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
| 3300012905|Ga0157296_10308987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300012912|Ga0157306_10166581 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012913|Ga0157298_10063981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 893 | Open in IMG/M |
| 3300013306|Ga0163162_13479742 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300013307|Ga0157372_11957632 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300014969|Ga0157376_10250319 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300015077|Ga0173483_10034280 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300015371|Ga0132258_10580931 | All Organisms → cellular organisms → Bacteria | 2811 | Open in IMG/M |
| 3300015371|Ga0132258_11425893 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300017965|Ga0190266_10134207 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300018031|Ga0184634_10481323 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018466|Ga0190268_10971400 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300018469|Ga0190270_11212540 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300019361|Ga0173482_10532958 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300019362|Ga0173479_10632339 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300019869|Ga0193705_1024196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1318 | Open in IMG/M |
| 3300025792|Ga0210143_1011494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1581 | Open in IMG/M |
| 3300025901|Ga0207688_10089635 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300025907|Ga0207645_10740436 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300025908|Ga0207643_10017893 | All Organisms → cellular organisms → Bacteria | 3881 | Open in IMG/M |
| 3300025920|Ga0207649_10153727 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300025926|Ga0207659_11264113 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300026095|Ga0207676_10119114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2223 | Open in IMG/M |
| 3300026116|Ga0207674_10353895 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300026118|Ga0207675_101953542 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300026142|Ga0207698_10251449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1618 | Open in IMG/M |
| 3300027821|Ga0209811_10063863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1277 | Open in IMG/M |
| 3300027907|Ga0207428_10143077 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300028705|Ga0307276_10010041 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300028716|Ga0307311_10271124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300028717|Ga0307298_10193588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300028719|Ga0307301_10005395 | All Organisms → cellular organisms → Bacteria | 3565 | Open in IMG/M |
| 3300028771|Ga0307320_10000421 | All Organisms → cellular organisms → Bacteria | 15247 | Open in IMG/M |
| 3300031092|Ga0308204_10130494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300031199|Ga0307495_10201404 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031455|Ga0307505_10021703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2964 | Open in IMG/M |
| 3300031547|Ga0310887_10348091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
| 3300031548|Ga0307408_100046726 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
| 3300031548|Ga0307408_100252254 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300031562|Ga0310886_10217468 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300031562|Ga0310886_10666257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300031731|Ga0307405_10552398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
| 3300031938|Ga0308175_100204672 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300031944|Ga0310884_10722876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300032002|Ga0307416_103002539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300032004|Ga0307414_11654873 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300033551|Ga0247830_11316531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 11.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.00% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_100220646 | 3300001686 | Soil | MTAEEHSSSAGRPEFDLDEERDDSTDDGAPVAGGLCRLDAPDSATDDDP |
| soilH2_101274142 | 3300003324 | Sugarcane Root And Bulk Soil | MTVEERSSSAGRPDLDLDEERDESADDGAPIAGGLCRLDAPDSEVDGDAA* |
| Ga0055468_101531742 | 3300003993 | Natural And Restored Wetlands | MTVEEQTSSAGRPELDLDEERTDRKDDGAPVAGGLCRLDAPDSAADEDAG* |
| Ga0055472_100163092 | 3300003998 | Natural And Restored Wetlands | SLSRFIARAERYRFERAMAAEEKSSSRGRPELDLGDDESAERENDGAPVAGGLCRLDAPDAAPAEEAG* |
| Ga0055472_102243131 | 3300003998 | Natural And Restored Wetlands | RPELDLDEERTDRKDDGAPVAGGLCRLDAPDSAADEDAG* |
| Ga0063454_1001230982 | 3300004081 | Soil | MTAEEHSSSAGRPEFDLDEERDDSTDDGAPVAGGLCRLDAPDSATDDDPG* |
| Ga0062593_1000219254 | 3300004114 | Soil | MTVEEHSSSAGRPELDLGDEPEPDDDTDRESGTVAGGLCRLSAPDSPEPESRS* |
| Ga0062593_1001150942 | 3300004114 | Soil | MTVEERSSSAGRPELDLDEERDETKDDGAPVAGGLCRLDAPDSHPDEDAD* |
| Ga0062593_1002756012 | 3300004114 | Soil | LSRFIARAERYRFGRAMTHEEQSSSAGLTQLDLDEERDEGKDEGAGVAGGLCRLDVPAAPADED* |
| Ga0062590_1018615402 | 3300004157 | Soil | MTHEEQSSSAGLTQLDLDEERDEGKDEGAGVAGGLCRLDVPAAPADED* |
| Ga0062590_1020013072 | 3300004157 | Soil | MTAEEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDAG* |
| Ga0063356_1001947482 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTVEERSSSAGRPELDLDEELDETKDDGSPVAGGLCRLDAPDSGAAADDD* |
| Ga0062595_1004365102 | 3300004479 | Soil | MTAEEHSSSAGRPELDLDDERDDPKDQGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0062592_1008981081 | 3300004480 | Soil | RSISFSRFIARAERYRFRRAMTVEERSSSAGRPELDLDEERDETKDDGAPVAGGLCRLDAPDSHPDEDAD* |
| Ga0062592_1024207811 | 3300004480 | Soil | RRSISLSRFIARAERYRFKRAMTAEEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDAG* |
| Ga0062592_1025513651 | 3300004480 | Soil | RRSISLSRFIARAERYRFERAMTAEEHSSSAGRPELDLDDERDDPKDQGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0062591_1003662701 | 3300004643 | Soil | RYRFGRAMTHEEQSSSAGLTQLDLDEERDEGKDEGAGVAGGLCRLDVPAAPADED* |
| Ga0062594_1031455021 | 3300005093 | Soil | RSISLSRFIARAERYRFERVMTAEEHSSSAGRPELDLDEERDDPKDDGAPVAGGLCRLDAPDSTADEDPG* |
| Ga0065705_102120561 | 3300005294 | Switchgrass Rhizosphere | MTAEEHSSSAGRPDLDLDEERDDGKEDGAPVAGGLCRLDAPDSAADEDAG* |
| Ga0070658_101487202 | 3300005327 | Corn Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPEDEGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0070683_1006319932 | 3300005329 | Corn Rhizosphere | YRFKRAMTVEERSSSAGRPELDLDEERDESTDDGAPIAGGLCRLDAPDSEVDGDAA* |
| Ga0070670_1021131982 | 3300005331 | Switchgrass Rhizosphere | MTAEEHSSSAGRPELDLDDERDDAKDQGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0066388_1014938591 | 3300005332 | Tropical Forest Soil | MTPEEHSSSAGGPELDLDEENPEREEEDVPVDGGLLRLDAPDSRVEDESD* |
| Ga0070689_1007316551 | 3300005340 | Switchgrass Rhizosphere | MTAEEHSSFAGRPELDLDDERDDPKDQGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0070701_107253902 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LSRFIARAERYRFERVMTAEEHSSSAGRPELDLDEERDDPKDDGAPVAGGLCRLDAPDSTADEDPG* |
| Ga0070705_1005552711 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEEHSSSAGRPELDLDDERDDAKDQGAPVAGGLCRLDAPDSAPDEDSG* |
| Ga0070678_1009029391 | 3300005456 | Miscanthus Rhizosphere | AGRPELDLDDERDDAKDQGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0068867_1013156582 | 3300005459 | Miscanthus Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPKDEGAPVAGGLCRLDAPDSAADVDPG* |
| Ga0070698_1009785472 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEEHSSSAGRPEFDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0070693_1005940352 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSEEHSSSAGRPELDLDEERDEGTDEGAGVAGGLCRLDAPDSPPEED* |
| Ga0068856_1001922372 | 3300005614 | Corn Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPKDEGAPVAGGLCRLDAPDSAADEDSG* |
| Ga0068852_1006334892 | 3300005616 | Corn Rhizosphere | EHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0075288_10155171 | 3300005874 | Rice Paddy Soil | ELDLDEERDDGKGDGAPVAGGLCRLDAPDSATDEDAG* |
| Ga0081455_100331493 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTAEEHSSSAGRPELDLDEERDEGKDEGAPVDGGLCRLDAPTSPVDESAD* |
| Ga0082029_12502912 | 3300006169 | Termite Nest | MTLEERSSSAGRPELDLDEERDEGEDEGAPVDGGLCRLDAPVSSADDDSA* |
| Ga0075422_101177182 | 3300006196 | Populus Rhizosphere | MTAEEHSSSAGRPELDLDEERDDGKDEGAPVAGGLCRLDAPDSAADEDAG* |
| Ga0068865_1001398962 | 3300006881 | Miscanthus Rhizosphere | MTAEEHSSSAGRPELDLDEERDDPKDDGAPVAGGLCRLDAPDSTADEDPG* |
| Ga0111539_100160558 | 3300009094 | Populus Rhizosphere | MTAEEHSSSAGRPELDLDEERDDGKDEGALVAGGLCRLDAPDSAADEDAG* |
| Ga0105237_105438472 | 3300009545 | Corn Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPKDQGAPVAGGLCRLDAPDSTADEDPG* |
| Ga0105249_108626322 | 3300009553 | Switchgrass Rhizosphere | DLDDERDDPKDQGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0126307_1000040525 | 3300009789 | Serpentine Soil | MTAEEQSSSAGRPELDLAEERDDSKDDGAPVAGGLCRLDAPDSATDEDSG* |
| Ga0126313_104122302 | 3300009840 | Serpentine Soil | MTAEEHSSSAGRPELDLDEERDDSKDDGAPVAGGLCRLDAPDSAADEDSG* |
| Ga0126305_102861972 | 3300010036 | Serpentine Soil | MTAEEQSSSAGRPELDLDEERDDSKDDGAPVAGGLCRLDAPDSAADEDSG* |
| Ga0126315_110984681 | 3300010038 | Serpentine Soil | MTAEEQSSSAGRPELDLDEERDDSKDDGAPVAGGLCRLDAPDSAADEDSG |
| Ga0126312_101881451 | 3300010041 | Serpentine Soil | MTAAEQSSSVGRPELDLDEERDDGKDEGALVAGGLCRLDAPDSAVDEEAG* |
| Ga0126314_100672005 | 3300010042 | Serpentine Soil | MTAEEHSSSAGRPELDLDEERDDSTDDGAPVAGGLCRLDAPDSAADEDAG* |
| Ga0134128_100923095 | 3300010373 | Terrestrial Soil | MTAEEHSSFAGRPELDLDDERDDAKDQGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0134124_124856262 | 3300010397 | Terrestrial Soil | MTAEEHSSSAGRPELDLDEERDDGNEDGALVVGGLCRLDAPDSAADEDAG* |
| Ga0134122_105841202 | 3300010400 | Terrestrial Soil | MTSEEHSSSAGRPELDLDEERDEGADEGAGVAGGLCRLDAPDSPPEED* |
| Ga0150985_1168383002 | 3300012212 | Avena Fatua Rhizosphere | MTAEEHSSSAGRPELDLDEERDDSTDDGAPVAGGLCRLDAPDSATDDDPG* |
| Ga0157305_101079232 | 3300012891 | Soil | MTAEEQSSSAGRPELDLDEERDDGKDDGAPVAGGLCRLDAPDSVTDEDLG* |
| Ga0157299_100222773 | 3300012899 | Soil | MTAEEHSSSAGRPELDLDDERDDPKDQGAPVAGGLCRLDAPDSAADEDP |
| Ga0157299_100552222 | 3300012899 | Soil | MTAEEHSSSAGRPELDLDEERDDSNDDGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0157296_103089872 | 3300012905 | Soil | MTAEEHSSSAGRPELDLDEERDDPKDDGAPVAGGLCRLDAPDSAADEDPG* |
| Ga0157306_101665812 | 3300012912 | Soil | MTAEEHSSSAGRPELDLDEERDDGNEDGALVAGGLCRLDAPDSAADEDAG* |
| Ga0157298_100639812 | 3300012913 | Soil | IARAERYRFRRAMTVEERSSSAGRPELDLDEERDETKDDSAPVAGGLCRLDAPDSHPDEDAD* |
| Ga0163162_134797421 | 3300013306 | Switchgrass Rhizosphere | MTAEEHSSSAGRPELDLDEERDDSKDDGAPVAGGLCRLDAPDSPADEDPG* |
| Ga0157372_119576322 | 3300013307 | Corn Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPKDQGAPVAGGLCRLDAPDSAAAEDAG* |
| Ga0157376_102503194 | 3300014969 | Miscanthus Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPKDQGAPVAGGLCRLDAPDSAADED |
| Ga0173483_100342804 | 3300015077 | Soil | MTAEEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAADED |
| Ga0132258_105809315 | 3300015371 | Arabidopsis Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPEDEGAPVAGGLCRLDAPDSAADEDSG* |
| Ga0132258_114258933 | 3300015371 | Arabidopsis Rhizosphere | MTHEEQSSSAGLTQLDLDDERDEGKDEGAGVAGGLCRLDVPAAPADED* |
| Ga0190266_101342072 | 3300017965 | Soil | MTAEEHSSSAGRPDLDLDEERDDGKEDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0184634_104813232 | 3300018031 | Groundwater Sediment | MTAEEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0190268_109714002 | 3300018466 | Soil | MTAEEHSSSAGRPDLDLDEERGDGKEDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0190270_112125402 | 3300018469 | Soil | MTAEERSSSAGRPELDLDEERDDSKDDGAPVAGGLCRLDAPDSAADEDPG |
| Ga0173482_105329582 | 3300019361 | Soil | MTAEEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAANEDAG |
| Ga0173479_106323392 | 3300019362 | Soil | MTVEERSSSAGRPELDLDEERDETKDDGAPVAGGLCRLDAPDSHPDEDA |
| Ga0193705_10241962 | 3300019869 | Soil | RYRFKRAMTAEEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0210143_10114941 | 3300025792 | Natural And Restored Wetlands | EKSSSRGRPELDLGDDESAERENDGAPVAGGLCRLDAPDAAPAEEAG |
| Ga0207688_100896352 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPKDQGAPVAGGLCRLDAPDSAADEDPG |
| Ga0207645_107404362 | 3300025907 | Miscanthus Rhizosphere | MTHEEQSSSAGLTQLDLDEERDEGKDEGAGVAGGLCRLDVPAAPADED |
| Ga0207643_100178935 | 3300025908 | Miscanthus Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPEDEGAPVAGGLCRLDAPDSAADEDPG |
| Ga0207649_101537272 | 3300025920 | Corn Rhizosphere | MTAEEHSSSAGRPELDLDDERDDAKDQGAPVAGGLCRLDAPDSAADEDPG |
| Ga0207659_112641132 | 3300025926 | Miscanthus Rhizosphere | MTAEEHSSFAGRPELDLDDERDDAKDQGAPVAGGLCRLDAPDSAADEDPG |
| Ga0207676_101191141 | 3300026095 | Switchgrass Rhizosphere | SGSPYRRSISLSRFIARAERYRFERVMTAEEHSSSAGRPELDLDEERDDPKDDGAPVAGGLCRLDAPDSTADEDPG |
| Ga0207674_103538953 | 3300026116 | Corn Rhizosphere | MTAEEHSSSAGRPELDLDEERDDGNEDGALVVGGLCRLDAPDSAADEDAG |
| Ga0207675_1019535422 | 3300026118 | Switchgrass Rhizosphere | MTAEEHSSSAGRPELDLDDERDDPEDEGAPVAGGLCRLDAPDSAADEDLG |
| Ga0207698_102514492 | 3300026142 | Corn Rhizosphere | DLDDERDDPKDQGAPVAGGLCRLDAPDSAADEDPG |
| Ga0209811_100638632 | 3300027821 | Surface Soil | MTAEEHSSSAGRPEFDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0207428_101430773 | 3300027907 | Populus Rhizosphere | MTAEEHSSSAGRPELDLDEERDDGKDEGAPVAGGLCRLDAPDSAADEDAG |
| Ga0307276_100100412 | 3300028705 | Soil | MTAEERSSSAGRPELDLDEERDDSMDDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0307311_102711242 | 3300028716 | Soil | SSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0307298_101935881 | 3300028717 | Soil | IARAERYRFKRAMTAEEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0307301_100053955 | 3300028719 | Soil | MTAEEHSSSAGRPELDLDEERDDSKDDGAPVTGGLCRLDAPDSGADEDPG |
| Ga0307320_1000042114 | 3300028771 | Soil | MTAEERSSSAGRPELDLDEERDDSKDYGAPVTGGLCRLDAPDSGADEDPG |
| Ga0308204_101304941 | 3300031092 | Soil | EEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPVSAADEDAG |
| Ga0307495_102014042 | 3300031199 | Soil | MTAEEHSSSAGRPELDLDEERDDGKDDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0307505_100217034 | 3300031455 | Soil | MTAEEHSSSAGRPELDLDEERDDGNEDGAPVAGGLCRLDAPDSAAAEDAG |
| Ga0310887_103480912 | 3300031547 | Soil | MTAEEHSSSAGRPELDLDEERDDGKDEGAPVAGGLCRLDAPDSAADEDSG |
| Ga0307408_1000467264 | 3300031548 | Rhizosphere | MTAEERSSSAGRPELDLDEERDDSKDDGAPVAGGLCRLDAPDSVTDEDPG |
| Ga0307408_1002522542 | 3300031548 | Rhizosphere | MTAEEHSSSAGRPEFDLDEDRDDGKDEGAPVAGGLCRLDAPDSAADEDAG |
| Ga0310886_102174682 | 3300031562 | Soil | MTAEEHSSSAGRPELDLDEERDEGNEDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0310886_106662571 | 3300031562 | Soil | FKRAMTAEEHSSTAGRPELDLDEERDEGNEDGAPVAGGLCRLDAPDSAADEDGG |
| Ga0307405_105523981 | 3300031731 | Rhizosphere | LDLDEDRDDGKDEGAPVAGGLCRLDAPDSAADEDAG |
| Ga0308175_1002046723 | 3300031938 | Soil | MTAEERSSSAGRPELDLDEERDDLNDDGAPVAGGLCRLDAPDSAADEDAG |
| Ga0310884_107228762 | 3300031944 | Soil | LSRFIARAERYRFKRAMTAEEHSSSAGRPELDLDEERDDGKDEGAPVAGGLCRLDAPDSAADEDAG |
| Ga0307416_1030025392 | 3300032002 | Rhizosphere | MTAEEHSSSAGRPELDLDEERDEGKDDGAPVAGGLCRLDAPDSVADEDAR |
| Ga0307414_116548732 | 3300032004 | Rhizosphere | MTAEEHSSSAGRPEFELDEDRDDGKDEGAPVAGGLCRLDAPDSAADEDAG |
| Ga0247830_113165312 | 3300033551 | Soil | MTAEEHSSSAGRPEFDLDEERDDGKDEGAPVAGGLCRLDAPDSAADEDAG |
| ⦗Top⦘ |