| Basic Information | |
|---|---|
| Family ID | F105837 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | KAESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.00 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.78% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01266 | DAO | 15.00 |
| PF00528 | BPD_transp_1 | 11.00 |
| PF02803 | Thiolase_C | 11.00 |
| PF12680 | SnoaL_2 | 4.00 |
| PF00440 | TetR_N | 4.00 |
| PF08818 | DUF1801 | 4.00 |
| PF01613 | Flavin_Reduct | 3.00 |
| PF09587 | PGA_cap | 3.00 |
| PF00005 | ABC_tran | 2.00 |
| PF13649 | Methyltransf_25 | 2.00 |
| PF13546 | DDE_5 | 1.00 |
| PF12681 | Glyoxalase_2 | 1.00 |
| PF13380 | CoA_binding_2 | 1.00 |
| PF07730 | HisKA_3 | 1.00 |
| PF12697 | Abhydrolase_6 | 1.00 |
| PF13382 | Adenine_deam_C | 1.00 |
| PF13231 | PMT_2 | 1.00 |
| PF01584 | CheW | 1.00 |
| PF04237 | YjbR | 1.00 |
| PF00561 | Abhydrolase_1 | 1.00 |
| PF00067 | p450 | 1.00 |
| PF01717 | Meth_synt_2 | 1.00 |
| PF01828 | Peptidase_A4 | 1.00 |
| PF01243 | Putative_PNPOx | 1.00 |
| PF01636 | APH | 1.00 |
| PF04542 | Sigma70_r2 | 1.00 |
| PF13556 | HTH_30 | 1.00 |
| PF08281 | Sigma70_r4_2 | 1.00 |
| PF07729 | FCD | 1.00 |
| PF00106 | adh_short | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 11.00 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 4.00 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 4.00 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 4.00 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 3.00 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.00 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.00 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.00 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.00 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.00 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.00 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.00 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.00 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.00 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.00 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.00 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.00 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.00 % |
| Unclassified | root | N/A | 27.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005366|Ga0070659_102049457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300005444|Ga0070694_100643975 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005467|Ga0070706_101433282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300005471|Ga0070698_100149672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2282 | Open in IMG/M |
| 3300005602|Ga0070762_10953270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300005764|Ga0066903_102176954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1069 | Open in IMG/M |
| 3300005764|Ga0066903_108417426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300005840|Ga0068870_10571069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 764 | Open in IMG/M |
| 3300006169|Ga0082029_1573972 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300009137|Ga0066709_103200158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
| 3300009553|Ga0105249_12695514 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300009815|Ga0105070_1001339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3285 | Open in IMG/M |
| 3300009821|Ga0105064_1007221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1921 | Open in IMG/M |
| 3300010039|Ga0126309_10793933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300010041|Ga0126312_10525127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
| 3300010048|Ga0126373_11716336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
| 3300010048|Ga0126373_12294029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300010358|Ga0126370_10180807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1573 | Open in IMG/M |
| 3300010358|Ga0126370_11721035 | Not Available | 604 | Open in IMG/M |
| 3300010360|Ga0126372_10318030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1378 | Open in IMG/M |
| 3300010361|Ga0126378_10211228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2021 | Open in IMG/M |
| 3300010361|Ga0126378_11643862 | Not Available | 730 | Open in IMG/M |
| 3300010366|Ga0126379_10357499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1493 | Open in IMG/M |
| 3300010366|Ga0126379_10370824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1469 | Open in IMG/M |
| 3300010376|Ga0126381_101546018 | Not Available | 959 | Open in IMG/M |
| 3300010398|Ga0126383_10200616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1915 | Open in IMG/M |
| 3300010937|Ga0137776_1518269 | Not Available | 667 | Open in IMG/M |
| 3300012199|Ga0137383_11370251 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012207|Ga0137381_11582256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300012209|Ga0137379_10483948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1146 | Open in IMG/M |
| 3300012357|Ga0137384_11306263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300012358|Ga0137368_10299445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
| 3300014829|Ga0120104_1089837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium HGW-Actinobacteria-9 | 609 | Open in IMG/M |
| 3300015261|Ga0182006_1287560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300015372|Ga0132256_102895655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300018027|Ga0184605_10018634 | All Organisms → cellular organisms → Bacteria | 2756 | Open in IMG/M |
| 3300018027|Ga0184605_10276731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300018027|Ga0184605_10387291 | Not Available | 627 | Open in IMG/M |
| 3300018028|Ga0184608_10460260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300018031|Ga0184634_10062469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1566 | Open in IMG/M |
| 3300018469|Ga0190270_11147616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300019767|Ga0190267_10067424 | Not Available | 1300 | Open in IMG/M |
| 3300021073|Ga0210378_10235472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300021433|Ga0210391_11496355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300021478|Ga0210402_11124112 | Not Available | 713 | Open in IMG/M |
| 3300021560|Ga0126371_10790263 | Not Available | 1095 | Open in IMG/M |
| 3300021560|Ga0126371_10886510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1036 | Open in IMG/M |
| 3300024245|Ga0247677_1023010 | Not Available | 891 | Open in IMG/M |
| 3300025906|Ga0207699_10647085 | Not Available | 772 | Open in IMG/M |
| 3300025928|Ga0207700_11610939 | Not Available | 574 | Open in IMG/M |
| 3300025933|Ga0207706_11229832 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300026498|Ga0257156_1105924 | Not Available | 585 | Open in IMG/M |
| 3300027056|Ga0209879_1049260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300027490|Ga0209899_1077967 | Not Available | 655 | Open in IMG/M |
| 3300027718|Ga0209795_10104991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300027826|Ga0209060_10049884 | Not Available | 2022 | Open in IMG/M |
| 3300027882|Ga0209590_10598029 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300028590|Ga0247823_10497609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 919 | Open in IMG/M |
| 3300028716|Ga0307311_10083540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300028722|Ga0307319_10080838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1033 | Open in IMG/M |
| 3300028744|Ga0307318_10084095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1068 | Open in IMG/M |
| 3300028875|Ga0307289_10045434 | Not Available | 1751 | Open in IMG/M |
| 3300028881|Ga0307277_10107291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1188 | Open in IMG/M |
| 3300028884|Ga0307308_10318797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300030510|Ga0268243_1034911 | Not Available | 1048 | Open in IMG/M |
| 3300031469|Ga0170819_11613248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300031546|Ga0318538_10634640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300031564|Ga0318573_10626944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300031572|Ga0318515_10335343 | Not Available | 811 | Open in IMG/M |
| 3300031640|Ga0318555_10747938 | Not Available | 528 | Open in IMG/M |
| 3300031736|Ga0318501_10296792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 862 | Open in IMG/M |
| 3300031748|Ga0318492_10028299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2500 | Open in IMG/M |
| 3300031748|Ga0318492_10029394 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300031751|Ga0318494_10012161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4102 | Open in IMG/M |
| 3300031751|Ga0318494_10033084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2655 | Open in IMG/M |
| 3300031771|Ga0318546_10187069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1410 | Open in IMG/M |
| 3300031771|Ga0318546_10511284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300031799|Ga0318565_10253759 | Not Available | 855 | Open in IMG/M |
| 3300031805|Ga0318497_10241041 | Not Available | 1002 | Open in IMG/M |
| 3300031821|Ga0318567_10178253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1182 | Open in IMG/M |
| 3300031835|Ga0318517_10422768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300031846|Ga0318512_10006261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4341 | Open in IMG/M |
| 3300031879|Ga0306919_10316880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1186 | Open in IMG/M |
| 3300031896|Ga0318551_10015892 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
| 3300031911|Ga0307412_10412945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
| 3300031946|Ga0310910_10108551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 2071 | Open in IMG/M |
| 3300032001|Ga0306922_12093512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 549 | Open in IMG/M |
| 3300032008|Ga0318562_10456002 | Not Available | 742 | Open in IMG/M |
| 3300032008|Ga0318562_10713295 | Not Available | 576 | Open in IMG/M |
| 3300032035|Ga0310911_10702541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
| 3300032052|Ga0318506_10252146 | Not Available | 782 | Open in IMG/M |
| 3300032090|Ga0318518_10389757 | Not Available | 715 | Open in IMG/M |
| 3300032094|Ga0318540_10085596 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300032159|Ga0268251_10027663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1735 | Open in IMG/M |
| 3300032180|Ga0307471_102518109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300032261|Ga0306920_104282352 | Not Available | 513 | Open in IMG/M |
| 3300033134|Ga0335073_10326496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1829 | Open in IMG/M |
| 3300033290|Ga0318519_10268623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.00% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070659_1020494571 | 3300005366 | Corn Rhizosphere | TLAKAEALGGSRVYGPNAVDDHMKTGALRDPAGNVFGVYEHRH* |
| Ga0070694_1006439751 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VEQTLASAESHGGSRVYGPMAVDDRMQTGAFRDPAGNMFGVYHRAAG* |
| Ga0070706_1014332821 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TRAVELGGAREYGPNPVDDHMQTGALRDPAGNVFGVYHHAPH* |
| Ga0070698_1001496721 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RAEELGGSRVYGPMPVDDHMQTGAFRDPAGNVFGVYHHAPH* |
| Ga0070762_109532701 | 3300005602 | Soil | VLGLAVELGGAREYGPNPVDDHMQTGALRDPAGNVFGVYHHAPH* |
| Ga0066903_1021769542 | 3300005764 | Tropical Forest Soil | LGGSRVYGPMAVDDHMQTGAFRDPAGNVFGVYHHGAH* |
| Ga0066903_1084174262 | 3300005764 | Tropical Forest Soil | SLGGTRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH* |
| Ga0068870_105710691 | 3300005840 | Miscanthus Rhizosphere | AKAESLGGSRVYGPNDVDDHMQTGALRDPAGNVFGVYSHPDHH* |
| Ga0082029_15739723 | 3300006169 | Termite Nest | EACLARAEALGGTREYGPRPVDDHSETGAFRDPAGNLFGVYRHGPH* |
| Ga0066709_1032001581 | 3300009137 | Grasslands Soil | TNVDDVESSLAKAVAMGGSRTYGPHDVDDHMQSGAIRDPAGNLFGVYHHAPH* |
| Ga0105249_126955142 | 3300009553 | Switchgrass Rhizosphere | GGGRVYGPNPVDDHMKTGALRDPAGNVFGVYEHHH* |
| Ga0105070_10013396 | 3300009815 | Groundwater Sand | AQAERLGAARVYGPNAVDDHTQTGAIRDPAGSVFGVYHHRH* |
| Ga0105064_10072213 | 3300009821 | Groundwater Sand | RLGATRIYGPDAVDDHMQTGAIRDPAGNVFGVYHHRHWGADLWE* |
| Ga0126309_107939331 | 3300010039 | Serpentine Soil | GVGDVEAILAGAEALGGTRVYGPIQAGEDTWTGAFRDPAGNVFGVYHRPAS* |
| Ga0126312_105251272 | 3300010041 | Serpentine Soil | TRVYGPNPVDDHTETGAFRDPAGNLLGVYRHGPH* |
| Ga0126373_117163362 | 3300010048 | Tropical Forest Soil | SRVYGPMPVDDHMQTGAFRDPAGNVFGVYHHAPH* |
| Ga0126373_122940291 | 3300010048 | Tropical Forest Soil | ARAEELGGSRVYGPMPVDDHMQTGAFRDPAGNVFGVYHHAPH* |
| Ga0126370_101808073 | 3300010358 | Tropical Forest Soil | ATLTRAEELGGSRVYGPMPVDDHMQTGAFRDPAGNVFGVYHHAPH* |
| Ga0126370_117210351 | 3300010358 | Tropical Forest Soil | LGGSRVHGPVAVDDHMQTGALHDPAGNIVGVYHHAPH* |
| Ga0126372_103180302 | 3300010360 | Tropical Forest Soil | LAKAESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH* |
| Ga0126378_102112281 | 3300010361 | Tropical Forest Soil | LARAEELGGSRVYGPMPVDDHMQTGAVRDPAGNVFGVYHHEPH* |
| Ga0126378_116438623 | 3300010361 | Tropical Forest Soil | SRIYGPMAVDDHMQTGAFRDPAGNVFGAYHHGEH* |
| Ga0126379_103574991 | 3300010366 | Tropical Forest Soil | LGGSRIYGPMAVDDHMQTGALRDPAGNVFGVYHHGEH* |
| Ga0126379_103708243 | 3300010366 | Tropical Forest Soil | GGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH* |
| Ga0126381_1015460183 | 3300010376 | Tropical Forest Soil | GSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH* |
| Ga0126383_102006163 | 3300010398 | Tropical Forest Soil | DSLGGARVYGPMAVGDSMQTGAFRDPAGNVFGVYHRAD* |
| Ga0137776_15182692 | 3300010937 | Sediment | ALAKAESLGGTRAYGPMAVDDHMQTGAFRDPAGNVFGVYHHGDH* |
| Ga0137383_113702512 | 3300012199 | Vadose Zone Soil | LGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGAH* |
| Ga0137381_115822561 | 3300012207 | Vadose Zone Soil | AKAESLGGSRIYGPMAVDDHMQTGALRDPAGNVFGVYLHGAH* |
| Ga0137379_104839481 | 3300012209 | Vadose Zone Soil | CLARAEEMCGTREYGPIDVGDHMQTGAIRDPAGNVFGVYHHVPH* |
| Ga0137384_113062632 | 3300012357 | Vadose Zone Soil | SRIYGPMAVDDHMQTGAFRDPAGNVFGIYHHGAH* |
| Ga0137368_102994451 | 3300012358 | Vadose Zone Soil | EELGGTRVYGPNAVDDHMQTGAFRDPAGSVFGVYHHGEH* |
| Ga0120104_10898372 | 3300014829 | Permafrost | ELGGTREYGPVDVDDHMQSGAFRDPVGNVFGVYHHEAH* |
| Ga0182006_12875602 | 3300015261 | Rhizosphere | GATRVYGPNPVDDHTETGAFRDPAGNVFGVYHHGPH* |
| Ga0132256_1028956551 | 3300015372 | Arabidopsis Rhizosphere | EALAKAESLGGSRVYGPNDVDDHMQTGALRDPARNVFGVYSHPDHH* |
| Ga0184605_100186345 | 3300018027 | Groundwater Sediment | ERLGGSRVYGPLAVGDHMKTGALRDPAGSVVGVYQHQH |
| Ga0184605_102767312 | 3300018027 | Groundwater Sediment | AKAEKLGGTREYGPNQIDDHMQSGAIRDPAGNLFGVYSHPPHD |
| Ga0184605_103872912 | 3300018027 | Groundwater Sediment | LGGTRVYGPNAVDDHMQTGAIRDPAGNVFGVYEHQH |
| Ga0184608_104602601 | 3300018028 | Groundwater Sediment | AAERLGATRVYGPDAVDDHMQTGAFRDPAGNVFGVYHHGPH |
| Ga0184634_100624694 | 3300018031 | Groundwater Sediment | TLAQAERLGATRVYGPNAVDDHTQTGAIRDPAGNVFGVYHHRH |
| Ga0190270_111476161 | 3300018469 | Soil | TDVEAALARAEALGGTPVYGPVQAGEGTRTGAFCDPVGNVFGVYHRAVS |
| Ga0190267_100674241 | 3300019767 | Soil | RAEALGGTREYGSKPVDDHTETGAFRDPTGNLFGVYHHRPH |
| Ga0210378_102354721 | 3300021073 | Groundwater Sediment | EALGGTRVYGPIQAGEGTRTGAFRDPAGNVFGVYHRAVS |
| Ga0210391_114963552 | 3300021433 | Soil | SLGGSRIYGPMAVDDHMQTGALRDPAGNVFGIYHHGEH |
| Ga0210402_111241122 | 3300021478 | Soil | RAVELGGAREYGPNPVDDHMQTGALRDPAGNVFGVYHHAPH |
| Ga0126371_107902631 | 3300021560 | Tropical Forest Soil | TLAKAESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0126371_108865102 | 3300021560 | Tropical Forest Soil | GTREYGPNPVDDHMQTGALRDPAGNVFGVYHHAPH |
| Ga0247677_10230101 | 3300024245 | Soil | LGGGRVYGPNQVDDHMQTGALTDPAGNVVGVYSHPDHH |
| Ga0207699_106470851 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | EELGGSRVYGPMAVDDHMQTGAFRDPAGNIFGVYHHAPH |
| Ga0207700_116109392 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGDH |
| Ga0207706_112298321 | 3300025933 | Corn Rhizosphere | TLARAEKLGGSRVYGPNPVDDHMKTGALRDPAGNVFGVYEHHH |
| Ga0257156_11059242 | 3300026498 | Soil | LGGAREYGPNPVDDHMQTGALRDPAGNVFGVYHHAPH |
| Ga0209879_10492601 | 3300027056 | Groundwater Sand | QAERLGATRIYGPDAVDDHMQTGAFRDPAGNVFGVYHHEAH |
| Ga0209899_10779671 | 3300027490 | Groundwater Sand | GTRVYGPNAVDDHMETGAFRDPAGSVFGVYHHGEH |
| Ga0209795_101049911 | 3300027718 | Agave | QTLAQAERLGATRVYGPDAVDDHMQTGAFRDPAGNVFGVYHHGPH |
| Ga0209060_100498844 | 3300027826 | Surface Soil | AKAESLGGSRVYGPMAVDDHMQTGAFRDPAGNVFGVYHHGDH |
| Ga0209590_105980292 | 3300027882 | Vadose Zone Soil | DLGGARVYGPNAVDDHMKTGAFRDPAGLIFGVYEHPEH |
| Ga0247823_104976092 | 3300028590 | Soil | ARAGSLGGTRVYGPKQVDDHTETGAFRDPAGNLVGVYHHGPH |
| Ga0307311_100835401 | 3300028716 | Soil | LARAASLGGTRVYGPKPVDDHTETGAFRDPAGNLVGVYHHGPH |
| Ga0307319_100808382 | 3300028722 | Soil | AEALGATRVYGPNPVDDHTETGAFRDPAGNLFGVYHHGPH |
| Ga0307318_100840952 | 3300028744 | Soil | ALARAAALGGTRVYGPIQAGEGTRTGAFRDPAGNVFGVYHRAVS |
| Ga0307289_100454342 | 3300028875 | Soil | ALARAEALGGTRVYGPIQAGEGTRTGAFRDPAGNVFGVYHRAPS |
| Ga0307277_101072911 | 3300028881 | Soil | EAALARAETLGGTRVYGPIEAGEGTRTGAFRDPAGNVFGVYHRAVS |
| Ga0307308_103187972 | 3300028884 | Soil | AETLGGTRVYGPIEAGEGTRTGAFRDPAGNVFGVYHRAVS |
| Ga0268243_10349111 | 3300030510 | Soil | AEALGGTRVYGPKPVDDHSETGAFRDPAGNLFGVYHHRPH |
| Ga0170819_116132481 | 3300031469 | Forest Soil | KAESLGGSRIYGPMAVDDHMQTGALRDPAGNVFGIYHHGEH |
| Ga0318538_106346402 | 3300031546 | Soil | VEQTLAKAESLGGTRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0318573_106269442 | 3300031564 | Soil | LGGSRIYGPMAVDDHMQTGALRDPAGNVFGVYHHGEH |
| Ga0318515_103353432 | 3300031572 | Soil | GSRIYGPMAVDDHMQTGAFCDPAGNVFGVYHHGEH |
| Ga0318555_107479381 | 3300031640 | Soil | VPDVAAVLATATELGGARVHGPVAVDDHMQTGALRDPAGNIVGVYHHAPH |
| Ga0318501_102967922 | 3300031736 | Soil | AEKLGGSREYGPLPAGDHTQAGAFRDPAGNVFGVYQHAAH |
| Ga0318492_100282991 | 3300031748 | Soil | AMAESLGGSRVYGPMAVDDHMQTGAFRDPAGNVFGVYHHGAH |
| Ga0318492_100293944 | 3300031748 | Soil | AEALALAEKLGGSREYGPLPAGDHTQAGAFRDPAGNVFGVYHHAAH |
| Ga0318494_100121617 | 3300031751 | Soil | ALALAEKLGGSREYGPLPAGDHTQAGAFRDPAGNVFGVYQHAAH |
| Ga0318494_100330841 | 3300031751 | Soil | LGGSRVYGPMAVADDMQTGAFRDPAGNVFGVYHRGAR |
| Ga0318546_101870693 | 3300031771 | Soil | ATELGGARVHGPVAVDDHMQTGALRDPAGNIVGVYHHAPH |
| Ga0318546_105112841 | 3300031771 | Soil | LAKAESLGGSRVYGPRAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0318565_102537591 | 3300031799 | Soil | VEQTLAKAESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGAYHHGGH |
| Ga0318497_102410412 | 3300031805 | Soil | QTLAKAESLGGSRIYGPVSVDDHMQTGGFRDPAGNVFGVYHHGEH |
| Ga0318567_101782531 | 3300031821 | Soil | LAKAESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0318517_104227681 | 3300031835 | Soil | LAKAESLGGSRIYGPMAVDDHMQTGALRDPAGNVFGVYHHGEH |
| Ga0318512_100062615 | 3300031846 | Soil | SLGGSRVYGPMAVADDMQTGAFRDPAGNVFGVYHRGAR |
| Ga0306919_103168801 | 3300031879 | Soil | GGTRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0306925_106303751 | 3300031890 | Soil | EALALAEKLGGSREYGPLPAGDHTQAGAFRDPAGNVFGVYQHATH |
| Ga0318536_103203331 | 3300031893 | Soil | VAEALALAEKLGGSREYGPLPAGDHTQAGAFRDPAGNVFGVYQHATH |
| Ga0318551_100158921 | 3300031896 | Soil | GTRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0307412_104129453 | 3300031911 | Rhizosphere | VEQALVRAAQLGGTRLYGPNAVDDHTQTGAFRDPAGNVFGVYHHGEH |
| Ga0310910_101085514 | 3300031946 | Soil | KAESLGGTRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0306922_120935121 | 3300032001 | Soil | KAESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0318562_104560021 | 3300032008 | Soil | EQTLAKAESLGGSRIYGPMAVDDHMQTGAFCDPAGNVFGVYHHGEH |
| Ga0318562_107132952 | 3300032008 | Soil | AKAESLGGSRIYGPVAPAENMQTGAFRDPAGNVFGVYHSGDH |
| Ga0310911_107025411 | 3300032035 | Soil | KAASLGGSRAYGPTAVGDHMQTGAFRDPAGNVFGVYHRAVH |
| Ga0318506_102521461 | 3300032052 | Soil | AKAESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0318518_103897572 | 3300032090 | Soil | EQTLAKAESLGGSRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0318540_100855963 | 3300032094 | Soil | AKAESLGGTRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| Ga0268251_100276632 | 3300032159 | Agave | TRVYGPDDVDDHMQTGALRDPAGNVFGVYHHEDHD |
| Ga0307471_1025181092 | 3300032180 | Hardwood Forest Soil | DVEQTLAKAEALGGSRIYGPMDVDDHMQTGALRDPAGNVFGVYHHGEH |
| Ga0306920_1042823521 | 3300032261 | Soil | LAKAESLGGTRAYGPMAVDDHMQTGAFRDPAGNVFGVYHHGDH |
| Ga0335073_103264961 | 3300033134 | Soil | GGARELGPVAVDDHMQTGALRDPAGNVFGVYSHEPH |
| Ga0318519_102686232 | 3300033290 | Soil | TLAKAESLGGTRIYGPMAVDDHMQTGAFRDPAGNVFGVYHHGEH |
| ⦗Top⦘ |