| Basic Information | |
|---|---|
| Family ID | F105834 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MDEYLKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (13.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (68.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.33% β-sheet: 0.00% Coil/Unstructured: 58.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF07394 | DUF1501 | 72.00 |
| PF02875 | Mur_ligase_C | 1.00 |
| PF04389 | Peptidase_M28 | 1.00 |
| PF03551 | PadR | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.00 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.00 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.00 % |
| Unclassified | root | N/A | 8.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003993|Ga0055468_10009840 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300004114|Ga0062593_103093172 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300004156|Ga0062589_100874477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300004156|Ga0062589_100901951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300004157|Ga0062590_102520078 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300004157|Ga0062590_102567743 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300004643|Ga0062591_101718715 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300004643|Ga0062591_101831015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300004643|Ga0062591_101977508 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300004643|Ga0062591_102723149 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005332|Ga0066388_106601723 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005334|Ga0068869_100458550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300005338|Ga0068868_101172647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300005343|Ga0070687_101252763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300005345|Ga0070692_10882778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300005354|Ga0070675_102167331 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005355|Ga0070671_101167230 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005564|Ga0070664_102088015 | Not Available | 538 | Open in IMG/M |
| 3300005577|Ga0068857_101948992 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005577|Ga0068857_102329362 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005578|Ga0068854_101937858 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005615|Ga0070702_101588325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300005616|Ga0068852_101469495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300005834|Ga0068851_11001105 | Not Available | 527 | Open in IMG/M |
| 3300005834|Ga0068851_11105102 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005842|Ga0068858_100144067 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300005843|Ga0068860_102314771 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006169|Ga0082029_1720686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300006358|Ga0068871_100427372 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300006755|Ga0079222_10267777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
| 3300006844|Ga0075428_100453459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1374 | Open in IMG/M |
| 3300006881|Ga0068865_101465189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 611 | Open in IMG/M |
| 3300006881|Ga0068865_101597298 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006954|Ga0079219_10123400 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300007004|Ga0079218_10287294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1326 | Open in IMG/M |
| 3300009093|Ga0105240_10964897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300009098|Ga0105245_11115131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300009098|Ga0105245_12292057 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009098|Ga0105245_12347767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300009098|Ga0105245_12925677 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009100|Ga0075418_11602990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300009101|Ga0105247_10050672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2555 | Open in IMG/M |
| 3300009148|Ga0105243_10673490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300009156|Ga0111538_12796922 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300009174|Ga0105241_11118479 | Not Available | 743 | Open in IMG/M |
| 3300009174|Ga0105241_11338526 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009177|Ga0105248_13121651 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010044|Ga0126310_10970431 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010166|Ga0126306_10780231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300010396|Ga0134126_11454729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300010399|Ga0134127_13605839 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010400|Ga0134122_10915876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300013296|Ga0157374_11118002 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300013297|Ga0157378_10373836 | Not Available | 1398 | Open in IMG/M |
| 3300013307|Ga0157372_11440569 | Not Available | 794 | Open in IMG/M |
| 3300013308|Ga0157375_11152607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300014325|Ga0163163_11791451 | Not Available | 674 | Open in IMG/M |
| 3300014968|Ga0157379_10673416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300014968|Ga0157379_10802665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300015374|Ga0132255_102023591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300018476|Ga0190274_10104777 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300021445|Ga0182009_10814583 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300025904|Ga0207647_10199403 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300025911|Ga0207654_11195096 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300025923|Ga0207681_10659397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300025933|Ga0207706_10479041 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300025942|Ga0207689_11458451 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025945|Ga0207679_10693588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300025960|Ga0207651_10932974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300025960|Ga0207651_10933474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300025981|Ga0207640_12144458 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300026032|Ga0208419_1043453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300026035|Ga0207703_10541116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
| 3300026035|Ga0207703_11354758 | Not Available | 684 | Open in IMG/M |
| 3300026088|Ga0207641_12497690 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026095|Ga0207676_10425648 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300026095|Ga0207676_10728874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300026116|Ga0207674_11607293 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300026116|Ga0207674_11716458 | Not Available | 596 | Open in IMG/M |
| 3300026116|Ga0207674_11788572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300026118|Ga0207675_100117939 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| 3300026118|Ga0207675_100361268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300026118|Ga0207675_101122071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300026142|Ga0207698_10774389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300026142|Ga0207698_11412462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300027787|Ga0209074_10088834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300027886|Ga0209486_11284993 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027909|Ga0209382_10430635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1465 | Open in IMG/M |
| 3300028380|Ga0268265_12542612 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300028381|Ga0268264_11427543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300028381|Ga0268264_11572809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300031455|Ga0307505_10006950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6104 | Open in IMG/M |
| 3300031547|Ga0310887_10883021 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031716|Ga0310813_11263126 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031908|Ga0310900_11959023 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031911|Ga0307412_10385045 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300032004|Ga0307414_10262089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1443 | Open in IMG/M |
| 3300032126|Ga0307415_101147634 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300032179|Ga0310889_10315269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300033412|Ga0310810_10454309 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 13.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 13.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 9.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026032 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055468_100098403 | 3300003993 | Natural And Restored Wetlands | AILAGEISATTKATLLKQLDQSDPVTKVVGLILGTPEFQRQ* |
| Ga0062593_1030931722 | 3300004114 | Soil | SKVMDDYLKIILAGEISVATKEAMLKQLDKSDPVTKVVGLILGTPEFQRQ* |
| Ga0062589_1008744771 | 3300004156 | Soil | LLAGDISAATRETLLKQLQPSDATTKVVGLILGTPEFQRQ* |
| Ga0062589_1009019512 | 3300004156 | Soil | YLKQLLAGDISAATRETLLKQLQPSDSTTKVVGLILGTPEFQRQ* |
| Ga0062590_1025200782 | 3300004157 | Soil | NGDQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDSTTKVVGLILGTPEFQRQ* |
| Ga0062590_1025677431 | 3300004157 | Soil | VQGTTVSLANTNGAQAKVMDEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0062591_1017187152 | 3300004643 | Soil | LKTILAGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0062591_1018310152 | 3300004643 | Soil | MDEYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ* |
| Ga0062591_1019775081 | 3300004643 | Soil | GNQSKVMDEYLKQLLAADISAATRETLLKQLQPSDSTTKVVGLILGTPEFQRQ* |
| Ga0062591_1027231492 | 3300004643 | Soil | SLATTNGAQAKVMDEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0066388_1066017231 | 3300005332 | Tropical Forest Soil | SKLSTDQSEVMADYLKILLAGEISVATKEAMLKQLDKSDPVTKVVGLILGTPEFQRQ* |
| Ga0068869_1004585501 | 3300005334 | Miscanthus Rhizosphere | VSLSTLNGDQAKVMDQYLKTLLAGEISSATRETLLKQLDPADPVTKVVGLILGTPEFQRQ |
| Ga0068868_1011726472 | 3300005338 | Miscanthus Rhizosphere | ILAAEVSAATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ* |
| Ga0070687_1012527632 | 3300005343 | Switchgrass Rhizosphere | DEYLKTLLAGDISAATRDALLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0070692_108827782 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | SNRVQGTRVDLAKSGEQAKVMDEYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ* |
| Ga0070675_1021673312 | 3300005354 | Miscanthus Rhizosphere | KTILAGEVSAATRATLVKQVEPADPITKVVGLILGTPEFQRQ* |
| Ga0070671_1011672301 | 3300005355 | Switchgrass Rhizosphere | KLMDEYLRTLLAGEISAATRETLLKQLDPADPVTKVVGLILGTPEFQRQ* |
| Ga0070664_1020880151 | 3300005564 | Corn Rhizosphere | AGANPEKRKMIDDSLKSILAGEVSTATRETLLKQVDQADPIAKVIGLILGTPEFQRQ* |
| Ga0068857_1019489922 | 3300005577 | Corn Rhizosphere | MDEYLKNLLAGEVSTATRAALVKQLDQSDPVTKVVGLILGTPEFQRQ* |
| Ga0068857_1023293622 | 3300005577 | Corn Rhizosphere | LAGEISTPTRETLLKQLDPADPVTKVVGLILGTPEFQRQ* |
| Ga0068854_1019378582 | 3300005578 | Corn Rhizosphere | TKVAGANTDKAKVIDESVKTILAGELSAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ |
| Ga0070702_1015883252 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | KTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0068852_1014694952 | 3300005616 | Corn Rhizosphere | DISAATRDALLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0068851_110011051 | 3300005834 | Corn Rhizosphere | EQAKVMDEYLKTLLTGDISAASREALLKQLEPTDPATKVVGLILGTPEFQRQ* |
| Ga0068851_111051021 | 3300005834 | Corn Rhizosphere | EQAKVMDEYLKTLLAGDISAATREALLKQLEPTDPVAKVVGLILGTPEFQRQ* |
| Ga0068858_1001440673 | 3300005842 | Switchgrass Rhizosphere | NGDQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDATTKVVGLILGTPEFQRQ* |
| Ga0068860_1023147711 | 3300005843 | Switchgrass Rhizosphere | ALANNRVQGTKVSLSQTKGEQVKVMDEYLKTLLAGDISAATREALLKQLEPSDPPTKVVGLILGTPEFQRQ* |
| Ga0082029_17206861 | 3300006169 | Termite Nest | RVSLSKTDGDQTKVMDEYLKTLLAGEISSPTRETLLKQLDPADPVTKVVGLILGTPEFQRQ* |
| Ga0068871_1004273722 | 3300006358 | Miscanthus Rhizosphere | ANTNGAQAKVMDEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0079222_102677771 | 3300006755 | Agricultural Soil | VMDDYLKTLLAGDISAATREALLKQLEPADPATKVVGLILGTPEFQRQ* |
| Ga0075428_1004534591 | 3300006844 | Populus Rhizosphere | TSQAKVLDQSLKTILAGEMSAGTRETLLKQLDQSDPVTKVVGLILGTPEFQRQ* |
| Ga0068865_1014651892 | 3300006881 | Miscanthus Rhizosphere | VDLSKLTANETSQAKVLDQSLKTILAGEMSAATRETLLKQLDQSDPVTKVVGLILGTPEIQRQ* |
| Ga0068865_1015972982 | 3300006881 | Miscanthus Rhizosphere | QSKVMDDYLKILLAGEISAGTREAMLKQLDKSDPVTKVVGLILGTPEFQRQ* |
| Ga0079219_101234001 | 3300006954 | Agricultural Soil | LNSDQSRVMDDYLKNLLAGEVSTATREALVKQLDQSDPVTKVVGLILGTPEFQRQ* |
| Ga0079218_102872942 | 3300007004 | Agricultural Soil | KRKLIDQSLRTILAGEVSAATRETLLKQVGDVDRADPVTKVVGLILGTPEFQRQ* |
| Ga0105240_109648972 | 3300009093 | Corn Rhizosphere | YLQTILAGDISASTKDALMKQLAQSDRPTKVVGLILGTPEFQRQ* |
| Ga0105245_111151311 | 3300009098 | Miscanthus Rhizosphere | DISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0105245_122920571 | 3300009098 | Miscanthus Rhizosphere | ETSQAKVLDQSLKTILAGEMSAATRETLLKQLDQSDTVTKVVGLILGTPEFQRQ* |
| Ga0105245_123477671 | 3300009098 | Miscanthus Rhizosphere | TVSLVKTNGEQAKVMDEYLKTLLAGDISAATRDALLKQLEPTDPATKVVGLILGTPEFQRQ* |
| Ga0105245_129256772 | 3300009098 | Miscanthus Rhizosphere | TVSLVKTNGEQAKVMDEYLKTILAGEISATTRETLLKQLEPSDPVTKVVGLILGTPEFQRQ* |
| Ga0075418_116029901 | 3300009100 | Populus Rhizosphere | TTILAGEVSATTKETLLKQVNEADPVAKVVGLILGTPEFQRQ* |
| Ga0105247_100506721 | 3300009101 | Switchgrass Rhizosphere | MDEYLKTILGGEISPATRETLLKQLEPSDPATKVVGLILGTP |
| Ga0105243_106734901 | 3300009148 | Miscanthus Rhizosphere | KVMDEYLKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0111538_127969222 | 3300009156 | Populus Rhizosphere | ILAGEISASTKEALMKQRGQSAPARKGARLILGTPEFQRQ* |
| Ga0105241_111184792 | 3300009174 | Corn Rhizosphere | VLDEYLKSMLAGDISASTREALTKQLKQTDPPTKVVGLILGTPEFQRQ* |
| Ga0105241_113385262 | 3300009174 | Corn Rhizosphere | LKSLLAGEISSPTRETLLKQLDPADPVTKVVGLILGTPEFQRQ* |
| Ga0105248_131216511 | 3300009177 | Switchgrass Rhizosphere | RRQLFDESVKTILAGELSAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ* |
| Ga0126310_109704311 | 3300010044 | Serpentine Soil | GTRVDLAKLTAGDMNQARMMDESLKTILAGEISQATRETLLKQLDQSDPPAKVVGLILGTPEFQRQ* |
| Ga0126306_107802311 | 3300010166 | Serpentine Soil | DESLKTILAGEVSAATRETLLKQLAQSDPVTKVVGLILGTPEFQRQ* |
| Ga0134126_114547291 | 3300010396 | Terrestrial Soil | AKVMDEYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ* |
| Ga0134127_136058391 | 3300010399 | Terrestrial Soil | NKMIDESLKTILAGEVSAATRATLLKQVEAADPITKVVGLILGTPEFQRQ* |
| Ga0134122_109158761 | 3300010400 | Terrestrial Soil | TSGDKSQSKVMDESLKTILAGEISSATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ* |
| Ga0157374_111180022 | 3300013296 | Miscanthus Rhizosphere | MDEYLKTILAGEISVATREALLKQLEPADPVTKVVGLILGTPEFQRQ* |
| Ga0157378_103738361 | 3300013297 | Miscanthus Rhizosphere | EISSATRETLLKQLDPADPVTKVVGLILGTPEFQRQ* |
| Ga0157372_114405692 | 3300013307 | Corn Rhizosphere | DLAKSGEQAKVMDEYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ* |
| Ga0157375_111526071 | 3300013308 | Miscanthus Rhizosphere | AGEVSAATRATLVKQVEPADPITKVVGLILGTPEFQRQ* |
| Ga0163163_117914512 | 3300014325 | Switchgrass Rhizosphere | MDEYLKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ* |
| Ga0157379_106734161 | 3300014968 | Switchgrass Rhizosphere | KTILAGEMSAATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ* |
| Ga0157379_108026651 | 3300014968 | Switchgrass Rhizosphere | LAGDISAATRETLLKQLHPSDATTKVVGLILGTPEFQRQ* |
| Ga0132255_1020235912 | 3300015374 | Arabidopsis Rhizosphere | PGTIVSLSKANGEQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDSTTKVVGLILGTPEFQRQ* |
| Ga0190274_101047773 | 3300018476 | Soil | DQSKLLDEYLKTILAGDISASTKEALAKQLRQSDPATKVVGLILGTPEFQRQ |
| Ga0182009_108145832 | 3300021445 | Soil | ETSQAKVMDESLKTILAGDISAATKETLLKQLAQNDPASKVVGLILGTPEFQRQ |
| Ga0207647_101994031 | 3300025904 | Corn Rhizosphere | RVDLTRFTSGDKSQSKVMDESLKTILAGEISSATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ |
| Ga0207654_111950961 | 3300025911 | Corn Rhizosphere | LSKLTANETSQAKVLDQSLKTILAGEMSAATRETLLKQLDQSDPVTKVVGLILGTPEFQR |
| Ga0207681_106593972 | 3300025923 | Switchgrass Rhizosphere | NVSLSKSNGDQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDSTTKVVGLILGTPEFQR |
| Ga0207706_104790412 | 3300025933 | Corn Rhizosphere | YLKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ |
| Ga0207689_114584511 | 3300025942 | Miscanthus Rhizosphere | VNLANTNGDQSKVLDEYLKSILAGDISASTKEALMKQLGQSDPATKVVGLILGTPEFQRQ |
| Ga0207679_106935882 | 3300025945 | Corn Rhizosphere | TLLAGDISAATREALLKQLEPTDPATKVVGLILGTPEFQRQ |
| Ga0207651_109329741 | 3300025960 | Switchgrass Rhizosphere | LLAGEISAGTREAMLKQLDKSDPVTKVVGLILGTPEFQRQ |
| Ga0207651_109334742 | 3300025960 | Switchgrass Rhizosphere | LANNRVQGTKVSLSQTNGEQAKVMDEYLKTLLAGDISAATREALLKQLEPSDPPTKVVGLILGTPEFQRQ |
| Ga0207640_121444582 | 3300025981 | Corn Rhizosphere | KVDLTKVAGANTDKAKVIDESVKTILAGELSAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ |
| Ga0208419_10434531 | 3300026032 | Natural And Restored Wetlands | AGEVSAATRQTLLKQVDQADPITKVVGLILGTPEFQRQ |
| Ga0207703_105411161 | 3300026035 | Switchgrass Rhizosphere | LSKSNGDQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDATTKVVGLILGTPEFQRQ |
| Ga0207703_113547581 | 3300026035 | Switchgrass Rhizosphere | TLLAGDISPATREALLKQLEPSDPATKVVGLILGTPEFQRQ |
| Ga0207641_124976902 | 3300026088 | Switchgrass Rhizosphere | ISAATRETLLKQLDPADPVTKVVGLILGTPEFQRQ |
| Ga0207676_104256481 | 3300026095 | Switchgrass Rhizosphere | NTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ |
| Ga0207676_107288741 | 3300026095 | Switchgrass Rhizosphere | DEYLKTLLAGDISASTREALLKQLEPSDPVTKVVGLILGTPEFQRQ |
| Ga0207674_116072932 | 3300026116 | Corn Rhizosphere | NLLAGEVSTATRAALVKQLDQSDPVTKVVGLILGTPEFQRQ |
| Ga0207674_117164581 | 3300026116 | Corn Rhizosphere | YLKSLLAGEISSPTRETLLKQLDPADPVAKVVGLILGTPEFQRQ |
| Ga0207674_117885722 | 3300026116 | Corn Rhizosphere | YLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ |
| Ga0207675_1001179394 | 3300026118 | Switchgrass Rhizosphere | TNGGQAKVMDEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ |
| Ga0207675_1003612683 | 3300026118 | Switchgrass Rhizosphere | LDEYLKTILAGEISASTKEALMKQLGQSDPATKVVGLILGTPEFQRQ |
| Ga0207675_1011220711 | 3300026118 | Switchgrass Rhizosphere | LAGEISAGTREAMLKQLDKSDPVTKVVGLILGTPEFQRQ |
| Ga0207698_107743891 | 3300026142 | Corn Rhizosphere | GANTDKAKVIDESVKTILAGELSAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ |
| Ga0207698_114124621 | 3300026142 | Corn Rhizosphere | TILAAEVSAATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ |
| Ga0209074_100888342 | 3300027787 | Agricultural Soil | MDDYLKTLLAGDISAATREALLKQLEPADPATKVVGLILGTPEFQRQ |
| Ga0209486_112849931 | 3300027886 | Agricultural Soil | APIVKENTEKKKLVDESLKLILAGDVSAATRETLLKQVDQSDPITKVVGLILGTPEFQRQ |
| Ga0209382_104306351 | 3300027909 | Populus Rhizosphere | RLLDEYLKTILAGEISASTKEALMKQLGQSDPATKVVGLILGTPEFQRQ |
| Ga0268265_125426121 | 3300028380 | Switchgrass Rhizosphere | EYLKILLAGEISADTRETMLKQLDPSDPVTKVVGLILGTPEFQRQ |
| Ga0268264_114275432 | 3300028381 | Switchgrass Rhizosphere | NRAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ |
| Ga0268264_115728092 | 3300028381 | Switchgrass Rhizosphere | KTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ |
| Ga0307505_100069508 | 3300031455 | Soil | AGEVSTATKETLLKQLDQADPIAKVVGLILGTPEFQRQ |
| Ga0310887_108830212 | 3300031547 | Soil | ILAREVSAATRATLLKQVEAADPITKVVGLILGTPEFQRQ |
| Ga0310813_112631262 | 3300031716 | Soil | LAKLDGDQGKVLDEYLQTILAGEISATTKEALRKQLAQTDPPTKVVGLILGTPEFQRQ |
| Ga0310900_119590232 | 3300031908 | Soil | ISAATRETLLKQLEPSDPATKVVGLILGTPEFQRQ |
| Ga0307412_103850452 | 3300031911 | Rhizosphere | TRVDLTRFTSGDKSQSKVMDESLKTILAGEISSATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ |
| Ga0307414_102620892 | 3300032004 | Rhizosphere | QSKVIDDYLKILLAGEISAATKEAMLKQLDKSDPVTKVVGLILGTPEFQRQ |
| Ga0307415_1011476342 | 3300032126 | Rhizosphere | NTDKSKLIDESLKTILAGEVSATTKQTLLKQVDQSDPITKVVGLILGTPEFQRQ |
| Ga0310889_103152691 | 3300032179 | Soil | NKMIDESLKTILAGEVSAATRATLVKQVEPADPITKVVGLILGTPEFQRQ |
| Ga0310810_104543091 | 3300033412 | Soil | EYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ |
| ⦗Top⦘ |