| Basic Information | |
|---|---|
| Family ID | F105824 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGSSAVRALD |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.00 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.05% β-sheet: 5.41% Coil/Unstructured: 90.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13379 | NMT1_2 | 66.00 |
| PF13614 | AAA_31 | 1.00 |
| PF12323 | HTH_OrfB_IS605 | 1.00 |
| PF13469 | Sulfotransfer_3 | 1.00 |
| PF00005 | ABC_tran | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.00 % |
| Unclassified | root | N/A | 15.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101202819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101288376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10117979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1063 | Open in IMG/M |
| 3300005166|Ga0066674_10158665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1070 | Open in IMG/M |
| 3300005338|Ga0068868_100747417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
| 3300005434|Ga0070709_10446601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 973 | Open in IMG/M |
| 3300005435|Ga0070714_100843050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
| 3300005530|Ga0070679_100811365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300005598|Ga0066706_10247106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1388 | Open in IMG/M |
| 3300006028|Ga0070717_11426450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300006052|Ga0075029_101343428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300006086|Ga0075019_10934355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300006172|Ga0075018_10166461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1026 | Open in IMG/M |
| 3300006173|Ga0070716_100542392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 865 | Open in IMG/M |
| 3300006573|Ga0074055_10014205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2574 | Open in IMG/M |
| 3300006576|Ga0074047_11583807 | Not Available | 532 | Open in IMG/M |
| 3300006580|Ga0074049_12896371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300007258|Ga0099793_10271560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300009143|Ga0099792_10475909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
| 3300009174|Ga0105241_12215204 | Not Available | 545 | Open in IMG/M |
| 3300010159|Ga0099796_10069158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1270 | Open in IMG/M |
| 3300010322|Ga0134084_10286828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300010360|Ga0126372_10313404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1386 | Open in IMG/M |
| 3300010373|Ga0134128_10893835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 983 | Open in IMG/M |
| 3300010373|Ga0134128_12427733 | Not Available | 578 | Open in IMG/M |
| 3300010376|Ga0126381_100422973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1862 | Open in IMG/M |
| 3300010379|Ga0136449_102250451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
| 3300010403|Ga0134123_10040121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3468 | Open in IMG/M |
| 3300012200|Ga0137382_10447817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300012200|Ga0137382_11217468 | Not Available | 534 | Open in IMG/M |
| 3300012208|Ga0137376_10372190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1241 | Open in IMG/M |
| 3300012356|Ga0137371_11188063 | Not Available | 570 | Open in IMG/M |
| 3300012507|Ga0157342_1022570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
| 3300013102|Ga0157371_10299825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1163 | Open in IMG/M |
| 3300013105|Ga0157369_12487349 | Not Available | 524 | Open in IMG/M |
| 3300015241|Ga0137418_10442022 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300015265|Ga0182005_1132532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300015372|Ga0132256_100945457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 978 | Open in IMG/M |
| 3300016294|Ga0182041_10273338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1387 | Open in IMG/M |
| 3300016294|Ga0182041_12027443 | Not Available | 536 | Open in IMG/M |
| 3300017959|Ga0187779_10806774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300017995|Ga0187816_10270088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300018034|Ga0187863_10529242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300018086|Ga0187769_10936842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
| 3300018431|Ga0066655_10550145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300019361|Ga0173482_10129045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 958 | Open in IMG/M |
| 3300020581|Ga0210399_11292868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300021088|Ga0210404_10760218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300021559|Ga0210409_10684094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300021560|Ga0126371_13014570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300021560|Ga0126371_13546435 | Not Available | 527 | Open in IMG/M |
| 3300021560|Ga0126371_13819256 | Not Available | 508 | Open in IMG/M |
| 3300022467|Ga0224712_10376168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300022533|Ga0242662_10221073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300024186|Ga0247688_1043984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
| 3300024245|Ga0247677_1060031 | Not Available | 558 | Open in IMG/M |
| 3300025735|Ga0207713_1224221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300025903|Ga0207680_10398550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 972 | Open in IMG/M |
| 3300025904|Ga0207647_10034652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3221 | Open in IMG/M |
| 3300025928|Ga0207700_11162682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300025929|Ga0207664_10856691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
| 3300025929|Ga0207664_11142170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300025941|Ga0207711_10671846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
| 3300025945|Ga0207679_11187550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300025986|Ga0207658_10635029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
| 3300026041|Ga0207639_10821885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 866 | Open in IMG/M |
| 3300026078|Ga0207702_11161444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300026317|Ga0209154_1295837 | Not Available | 534 | Open in IMG/M |
| 3300026498|Ga0257156_1035690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1011 | Open in IMG/M |
| 3300027050|Ga0209325_1004091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1481 | Open in IMG/M |
| 3300027119|Ga0209522_1027942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300027853|Ga0209274_10689982 | Not Available | 527 | Open in IMG/M |
| 3300027884|Ga0209275_10456512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300028713|Ga0307303_10180350 | Not Available | 517 | Open in IMG/M |
| 3300028789|Ga0302232_10571246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300030043|Ga0302306_10061841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1468 | Open in IMG/M |
| 3300030580|Ga0311355_10950186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300030993|Ga0308190_1012412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1270 | Open in IMG/M |
| 3300031236|Ga0302324_101140984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1044 | Open in IMG/M |
| 3300031421|Ga0308194_10029166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1283 | Open in IMG/M |
| 3300031543|Ga0318516_10604112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
| 3300031679|Ga0318561_10799378 | Not Available | 518 | Open in IMG/M |
| 3300031716|Ga0310813_10567805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1000 | Open in IMG/M |
| 3300031723|Ga0318493_10527361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300031769|Ga0318526_10057843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1493 | Open in IMG/M |
| 3300031778|Ga0318498_10187576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 939 | Open in IMG/M |
| 3300031780|Ga0318508_1186736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300031820|Ga0307473_11549464 | Not Available | 504 | Open in IMG/M |
| 3300031896|Ga0318551_10372835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300031897|Ga0318520_10188128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1213 | Open in IMG/M |
| 3300031942|Ga0310916_10582436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
| 3300032044|Ga0318558_10193597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 990 | Open in IMG/M |
| 3300032059|Ga0318533_11091796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300032180|Ga0307471_102837534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
| 3300032261|Ga0306920_100845877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1341 | Open in IMG/M |
| 3300032261|Ga0306920_101071078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1171 | Open in IMG/M |
| 3300032805|Ga0335078_10221569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2606 | Open in IMG/M |
| 3300032805|Ga0335078_11708610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 690 | Open in IMG/M |
| 3300032828|Ga0335080_11124316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
| 3300032955|Ga0335076_11079363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1012028192 | 3300002245 | Forest Soil | MVRQVNSVTVTDRRAAPSVGGSVRLTGVSKVFGRGRTAVRALDQV |
| JGIcombinedJ26739_1012883761 | 3300002245 | Forest Soil | MVRQVSSVTVTDRRAAPPVGGQRDSVRLTAVSKVFGRGES |
| JGIcombinedJ51221_101179792 | 3300003505 | Forest Soil | VSRVTVTDRRTAPPVEGVDGSVRLTGVSKVFGRGSSAVRALDKVSLEV |
| Ga0066674_101586652 | 3300005166 | Soil | MVRQVSSVTVADRRAALPVRGHRDSVRLTGVSKVFGRGESAVRALDNVSLEVPP |
| Ga0068868_1007474171 | 3300005338 | Miscanthus Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVSLEVPPGE |
| Ga0070709_104466011 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVSLEVP |
| Ga0070714_1008430501 | 3300005435 | Agricultural Soil | MVRQVNSVTVTDRRAAPPVGGIRESVRLTSVSKVFGRGSSAVRALDQVSLEV |
| Ga0070679_1008113651 | 3300005530 | Corn Rhizosphere | MVRQVNSVTVTDRRAAPQVGEPVKLTSVSKVFGRGGAAVRALDQ |
| Ga0066706_102471061 | 3300005598 | Soil | MVRQVNSVTVTDRRAAPPVGSQRDSVRLTAVSKVFGRGESAVRALDNVT |
| Ga0070717_114264501 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRVTITDRRAAPPVAGAAGSVRLAGVSKVFGRGSSAVRALDDVSLEVA |
| Ga0075029_1013434281 | 3300006052 | Watersheds | VNRVTVTDRRAAPPIGGVGVSVRLAGVSKVFGRGASAVRALDQVSL |
| Ga0075019_109343551 | 3300006086 | Watersheds | VNRVTVADRRTAPPVGGVGVSVRLADVSKVFGRGASAVRA |
| Ga0075018_101664611 | 3300006172 | Watersheds | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGDSAVRALDNV |
| Ga0070716_1005423921 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRQVNSVTVTDRRAAPPVGGIRESVRLTSVSKVF |
| Ga0074055_100142053 | 3300006573 | Soil | VTVTNRRAAPPSQGSVRLTGVSKVFGRGSSAVRALDQVS |
| Ga0074047_115838071 | 3300006576 | Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRA |
| Ga0074049_128963711 | 3300006580 | Soil | MVRQVSSVTVTDRRAAPPVGGIRESVRLTSVSKVFGRGSSAVRALDQVS |
| Ga0099793_102715601 | 3300007258 | Vadose Zone Soil | MVRQVSSVTVTDRRAAPPVGGQRDSVRLTAVCKVFGRGESAVRALDHVTLEVTPGE |
| Ga0099792_104759092 | 3300009143 | Vadose Zone Soil | MVRQVSSVTVTDRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDKVSLE |
| Ga0105241_122152041 | 3300009174 | Corn Rhizosphere | MVRQVNSVTVTDRRAAPQVGEPVKLTSVSKVFGRGGAA |
| Ga0099796_100691582 | 3300010159 | Vadose Zone Soil | MVRQVSSVTVTDRRAAPPVGGQRESVRLTAVSKVFG |
| Ga0134084_102868282 | 3300010322 | Grasslands Soil | MVRQVSSVTVTDRRAAPPIGGQRDAVRLTGVSKVFGRGSSA |
| Ga0126372_103134043 | 3300010360 | Tropical Forest Soil | MVRQVSSVTVADRRAAPPVGGQRDPVRLTAVSKVFGRGESAV |
| Ga0134128_108938352 | 3300010373 | Terrestrial Soil | MVRQVSSVTVADRRAAPQAGLRRDSVRLTAVSKVFGRGESAVRALDNVSLEVPPG |
| Ga0134128_124277332 | 3300010373 | Terrestrial Soil | MVRQVNSVTVTDRRAAPPVGEPVTLTSVSKVFGRGSSAVRALDQVSLEVPPGEFT |
| Ga0126381_1004229731 | 3300010376 | Tropical Forest Soil | MVRHVSSVTVTDRRAAPPTGHAVRLTGVSKVFGRGSSAVR |
| Ga0136449_1022504511 | 3300010379 | Peatlands Soil | MVRQVSSVTVTDRRAAPPVAGAVRLTGVSKVFGRGSS |
| Ga0134123_100401211 | 3300010403 | Terrestrial Soil | MVRQVSSVTVADRRAAPPVGGQRDAVRLTGVSKVFGRGESAV |
| Ga0137382_104478172 | 3300012200 | Vadose Zone Soil | MVRQVSSVTVTDRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVTLE |
| Ga0137382_112174681 | 3300012200 | Vadose Zone Soil | MVRQVSTVTVTDRRAAPPTGDLREAVRLTDVSKVFGRGSSAVRALDNVSL |
| Ga0137376_103721901 | 3300012208 | Vadose Zone Soil | MVRQVSTVTVTDRRAAPPTGDLREAVRLTGVSKVFGRGSSAVRALDNVSLEVPP |
| Ga0137371_111880632 | 3300012356 | Vadose Zone Soil | MVRQVNSVTVTDRRAAPQAGLQRDSVRLTGVSKVFGRGASAVRALDQVSLEVP |
| Ga0157342_10225701 | 3300012507 | Arabidopsis Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVS |
| Ga0157371_102998251 | 3300013102 | Corn Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDN |
| Ga0157369_124873491 | 3300013105 | Corn Rhizosphere | MVRQVNSVTVTDRRAAPQVGEPVKLTSVSKVFGRGGAAVRA |
| Ga0137418_104420223 | 3300015241 | Vadose Zone Soil | MVRQVSSVTVTDRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVTLEVPPGEF |
| Ga0182005_11325321 | 3300015265 | Rhizosphere | MVRQVNSVTVTDRRAAPPAGGLRGAVRLTGVSKVFGRGESAVRA |
| Ga0132256_1009454572 | 3300015372 | Arabidopsis Rhizosphere | MVRQVNSVTVTDRRAAPQAGDLTGQGVTVRLTGVSKVFGRGSSAVRALDQVSLEVPPG* |
| Ga0182041_102733382 | 3300016294 | Soil | VTVADRRAAPPAEGTRDAVRLTGVSKVFGRGSSAVRALDQVSLEV |
| Ga0182041_120274432 | 3300016294 | Soil | MVRQVNSVTVANRRTAPPAAGVRGAVRLTRVSKVFGRGSSAVRALDQVSLEVPPG |
| Ga0187779_108067741 | 3300017959 | Tropical Peatland | MVRQVNSVAVSDERSAVGGSVRLTGVSKVFGRGSSAVR |
| Ga0187816_102700881 | 3300017995 | Freshwater Sediment | VSPVTVTDRPASAVGGSVQLTTVTKVFGRGSSAVRALDQ |
| Ga0187863_105292421 | 3300018034 | Peatland | MVRQVNSVTVTDRRAAPPVGGPVKLADVSKVFGQGSSAVRALDHISLEVSP |
| Ga0187769_109368421 | 3300018086 | Tropical Peatland | VTVTDRAAAPAVGEVKGAVRLAGVSKVFGRGSSAVRALDQVS |
| Ga0066655_105501451 | 3300018431 | Grasslands Soil | MVRQVSSVTVTDRRAAPPVGGSVRLTSVSKVFGRGASAVRALDQVSLEVRP |
| Ga0173482_101290451 | 3300019361 | Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTGVSKVFGRGESAVRALDNVSLEVPPGE |
| Ga0210399_112928682 | 3300020581 | Soil | MVRQVNSVTVTDRRAAPPTGDLRGMVRLTGVSKVFGRGGSAVRALDQVS |
| Ga0210404_107602181 | 3300021088 | Soil | MVRQVSSVTVTDRRAAPPVTGQRDSVRLTAVSKVFGRG |
| Ga0210409_106840942 | 3300021559 | Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGE |
| Ga0126371_130145701 | 3300021560 | Tropical Forest Soil | MVRQVNSVTVTDRRAAPPAGGLRGTVRLTSVSKVFGRGSSAVRA |
| Ga0126371_135464351 | 3300021560 | Tropical Forest Soil | MVRQVSSVTVTDRRAAPPVGRHRDPVRLTAVSKVFGRG |
| Ga0126371_138192561 | 3300021560 | Tropical Forest Soil | VTVTDRRAAPPTGHAVRLTGVSKVFGRGSSAVRALDQVSLE |
| Ga0224712_103761681 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALD |
| Ga0242662_102210732 | 3300022533 | Soil | MMRQVNSVTVTDRRAAPPVGGQRDSVRLTAVSKVFGRG |
| Ga0247688_10439842 | 3300024186 | Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDTV |
| Ga0247677_10600312 | 3300024245 | Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESA |
| Ga0207713_12242211 | 3300025735 | Switchgrass Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGES |
| Ga0207680_103985502 | 3300025903 | Switchgrass Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVF |
| Ga0207647_100346521 | 3300025904 | Corn Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAV |
| Ga0207700_111626821 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRQVNSVTVTDRRAAPPVGGSVTLTSVSKVFGRGSSA |
| Ga0207664_108566911 | 3300025929 | Agricultural Soil | MVRQVNSVTVTDRRAAPPVGGIRESVRLTSVSKVFGRGSSAVRALDQVSLEVPP |
| Ga0207664_111421701 | 3300025929 | Agricultural Soil | MVRQVNSVTVTDRRAAPPVGGSVTLTSVSKVFGRGSSAVRALDQVSLEVPPG |
| Ga0207711_106718461 | 3300025941 | Switchgrass Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTGVSKVFGRGESAVRALDNVS |
| Ga0207679_111875502 | 3300025945 | Corn Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTGVSKVF |
| Ga0207658_106350291 | 3300025986 | Switchgrass Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTGVSKVFGRGGS |
| Ga0207639_108218851 | 3300026041 | Corn Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTGVSKVFGRGG |
| Ga0207702_111614442 | 3300026078 | Corn Rhizosphere | MVRQVSSVTVADRRAAPPVGGQRDSVRLTGVSKVFGRGESAVR |
| Ga0209154_12958372 | 3300026317 | Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDKVS |
| Ga0257156_10356902 | 3300026498 | Soil | MVRQVSSVTVTDRRAAPPVGGQRDPVRLTAVSKVFGRGESA |
| Ga0209325_10040911 | 3300027050 | Forest Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGSSAVRALD |
| Ga0209522_10279422 | 3300027119 | Forest Soil | MVRQVNSVTVTDRRAAPPTGDLRGMVRLTGVSKVFGRGGSAVRALDQVSLEVPP |
| Ga0209274_106899821 | 3300027853 | Soil | MMRQVNSVAVTDRRAAPPVAGTVRLTGVSKVFGRGNSAVRAL |
| Ga0209275_104565122 | 3300027884 | Soil | MVRQVSSVTVTDRRAAPSVKGQRDSVRLTGVSKVFGRG |
| Ga0307303_101803501 | 3300028713 | Soil | MVRQVSSVTVTDRRAAPPVGGQRDSVRLTAVSKVFGRG |
| Ga0302232_105712462 | 3300028789 | Palsa | MVRQVISVAVTDRKAAPPVGTSVRLTGVSKVFGRGTSAVRALEDVS |
| Ga0302306_100618413 | 3300030043 | Palsa | MVRQVSSVAVTERRAPATAVATGAVRLTGVSKVFGRGSSAVQALDQVSLEV |
| Ga0311355_109501861 | 3300030580 | Palsa | MVRQVSSLAVTDHRVPATAKSTATGAVRLTGVSKVFGRGSSAVRALDQVSLEVA |
| Ga0308190_10124121 | 3300030993 | Soil | MVRQVSSVTVTDRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVSL |
| Ga0302324_1011409841 | 3300031236 | Palsa | MVRQVSSVTVTDRQTAPPIGTSVRMTGVSKVFGRG |
| Ga0308194_100291661 | 3300031421 | Soil | MVRQVSSVTVADRRAAPPVGGERDSVRLTAVSKVF |
| Ga0318516_106041121 | 3300031543 | Soil | MVRQVNSVTVTNRRTAPPAEDVRGAVRLTRASKVFGRGSSAVRALDQVSLEVPPGE |
| Ga0318561_107993781 | 3300031679 | Soil | MVRQVNSVTVTNRRTAPPAEDVRGAVRLTRASKVFGRGSSAVRALDQVSLEVP |
| Ga0310813_105678052 | 3300031716 | Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVSLEV |
| Ga0318493_105273611 | 3300031723 | Soil | MVRQVNSVTVTDRRAAPSAESMRGAVRLAGVSKVFGRGSSAEH |
| Ga0318526_100578431 | 3300031769 | Soil | MVRQVNSVTVTDRRAAPPAESTRGAVRLAGVSKVFGRGSSAVRALDQVSLEVPP |
| Ga0318498_101875761 | 3300031778 | Soil | MVRQVNSVTVTNRRTAPPAEDVRGAVRLTRVSKVFGRGS |
| Ga0318508_11867361 | 3300031780 | Soil | MVRQVNSVTVTDRRAAPSAESMRGAVRLAGVSKVFGRGSSA |
| Ga0307473_115494642 | 3300031820 | Hardwood Forest Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVSL |
| Ga0318551_103728352 | 3300031896 | Soil | MVRQVNSVTVTDRRAAPSAESMRGAVRLAGVSKVFGRGSSAVRALDQVSLEVP |
| Ga0318520_101881281 | 3300031897 | Soil | MVRQVNSVTVTDRRAAPSAESMRGAVRLAGVSKVFGRGSSAVRALDQVSLE |
| Ga0310916_105824361 | 3300031942 | Soil | MVRQVNSVTVTDRRAAPPAESMRGAVRLASVSKVFGRGSSAVRALDQVSLEVPPGEFI |
| Ga0318558_101935971 | 3300032044 | Soil | MVRQVNSVTVTDRRAAPPAESTRGAVRLAGVSKVFG |
| Ga0318533_110917962 | 3300032059 | Soil | MVRQVNSVTVTDRRAAPPAESMRGAVRLAGVSKVFGRGSSAVRALDQ |
| Ga0307471_1028375341 | 3300032180 | Hardwood Forest Soil | MVRQVSSVTVADRRAAPPVGGQRDSVRLTAVSKVFGRGESAVRALDNVSLEVPPGEFT |
| Ga0306920_1008458771 | 3300032261 | Soil | MVRQVNSVTVADRRTAPQAGDLRGQGVTVRLTGVSKVFGRGSSAVRALDQVSLEVPPG |
| Ga0306920_1010710782 | 3300032261 | Soil | MVRQVSSVTVTDRRAAPPVGGSVRLTSVSKVFGRGSSA |
| Ga0335078_102215691 | 3300032805 | Soil | VNRVTVTGRRAAPPAEKVKGAVRLTGVSKVFGRGSSAVRALDQVS |
| Ga0335078_117086101 | 3300032805 | Soil | MVRQVSSVTVTDRRTAPLAGGSVRLASVSKVFGRGGSAVRALDQVSLEVPPGEF |
| Ga0335080_111243162 | 3300032828 | Soil | MVRQVNSVTVTDRRAAPPAGDLRGHGVAVRLTSVSKVFGRGSSAVRALDQVSLEVPPGE |
| Ga0335076_110793632 | 3300032955 | Soil | MVRQVNSVMVTDRRAAPQAGGLRGQGATVRLTGVSKVFGRGNSVVRALDQVSL |
| ⦗Top⦘ |