 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105823 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MANGIVVLYFSRFGKPLQTHHKVVLDLGAKAIARIKGYKF |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 23.53% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 29.00 |
| PF00486 | Trans_reg_C | 8.00 |
| PF06823 | DUF1236 | 1.00 |
| PF13340 | DUF4096 | 1.00 |
| PF00873 | ACR_tran | 1.00 |
| PF03466 | LysR_substrate | 1.00 |
| PF00529 | CusB_dom_1 | 1.00 |
| PF02518 | HATPase_c | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.00 % |
| Unclassified | root | N/A | 33.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c1190590 | Not Available | 588 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0841405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1366 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10110570 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300004267|Ga0066396_10056408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300004633|Ga0066395_10206774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300005332|Ga0066388_102424836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300005332|Ga0066388_105049280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300005332|Ga0066388_108596881 | Not Available | 508 | Open in IMG/M |
| 3300005555|Ga0066692_10110015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1646 | Open in IMG/M |
| 3300005587|Ga0066654_10411970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300005764|Ga0066903_106445325 | Not Available | 612 | Open in IMG/M |
| 3300005983|Ga0081540_1195109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300006046|Ga0066652_101994992 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006049|Ga0075417_10638052 | Not Available | 544 | Open in IMG/M |
| 3300006049|Ga0075417_10640023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300006172|Ga0075018_10214795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300006847|Ga0075431_100564803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300006854|Ga0075425_102367251 | Not Available | 590 | Open in IMG/M |
| 3300009100|Ga0075418_11371502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300010048|Ga0126373_11784994 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010048|Ga0126373_12819772 | Not Available | 542 | Open in IMG/M |
| 3300010359|Ga0126376_12454766 | Not Available | 569 | Open in IMG/M |
| 3300010360|Ga0126372_11357312 | Not Available | 742 | Open in IMG/M |
| 3300010360|Ga0126372_13208759 | Not Available | 508 | Open in IMG/M |
| 3300010361|Ga0126378_10772424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300010361|Ga0126378_11532528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300010366|Ga0126379_11856016 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300010366|Ga0126379_12522985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300010366|Ga0126379_12838883 | Not Available | 580 | Open in IMG/M |
| 3300010376|Ga0126381_104854590 | Not Available | 517 | Open in IMG/M |
| 3300012022|Ga0120191_10039834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300012198|Ga0137364_11132348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → Beijerinckia indica | 588 | Open in IMG/M |
| 3300012200|Ga0137382_10565049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
| 3300012201|Ga0137365_10966682 | Not Available | 619 | Open in IMG/M |
| 3300012209|Ga0137379_10698721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J367 | 920 | Open in IMG/M |
| 3300012210|Ga0137378_11213478 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012357|Ga0137384_10498525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
| 3300012361|Ga0137360_11397548 | Not Available | 603 | Open in IMG/M |
| 3300012361|Ga0137360_11763449 | Not Available | 525 | Open in IMG/M |
| 3300012362|Ga0137361_10996817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J367 | 757 | Open in IMG/M |
| 3300012923|Ga0137359_11764387 | Not Available | 506 | Open in IMG/M |
| 3300012988|Ga0164306_10504877 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300012989|Ga0164305_10206786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1385 | Open in IMG/M |
| 3300016294|Ga0182041_10669416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 918 | Open in IMG/M |
| 3300016445|Ga0182038_11171587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 684 | Open in IMG/M |
| 3300018028|Ga0184608_10017737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2538 | Open in IMG/M |
| 3300018469|Ga0190270_10001638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10526 | Open in IMG/M |
| 3300020002|Ga0193730_1168298 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300021078|Ga0210381_10218594 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300021080|Ga0210382_10254715 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300021444|Ga0213878_10093426 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300021560|Ga0126371_10738355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1132 | Open in IMG/M |
| 3300021560|Ga0126371_12740595 | Not Available | 598 | Open in IMG/M |
| 3300021560|Ga0126371_12916457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300021560|Ga0126371_13294879 | Not Available | 546 | Open in IMG/M |
| 3300021968|Ga0193698_1023582 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300025915|Ga0207693_11227390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → Beijerinckia indica | 564 | Open in IMG/M |
| 3300025928|Ga0207700_10248649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300025929|Ga0207664_11258480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 659 | Open in IMG/M |
| 3300026310|Ga0209239_1033239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2435 | Open in IMG/M |
| 3300027502|Ga0209622_1012343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
| 3300027527|Ga0209684_1066300 | Not Available | 561 | Open in IMG/M |
| 3300027874|Ga0209465_10068813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1714 | Open in IMG/M |
| 3300028536|Ga0137415_10491155 | Not Available | 1035 | Open in IMG/M |
| 3300028878|Ga0307278_10556145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121 | 500 | Open in IMG/M |
| 3300031564|Ga0318573_10396383 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031573|Ga0310915_10841597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300031679|Ga0318561_10280937 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300031736|Ga0318501_10793860 | Not Available | 524 | Open in IMG/M |
| 3300031744|Ga0306918_11545153 | Not Available | 506 | Open in IMG/M |
| 3300031748|Ga0318492_10534024 | Not Available | 623 | Open in IMG/M |
| 3300031769|Ga0318526_10161245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300031770|Ga0318521_10586505 | Not Available | 673 | Open in IMG/M |
| 3300031770|Ga0318521_10866879 | Not Available | 551 | Open in IMG/M |
| 3300031771|Ga0318546_11306023 | Not Available | 509 | Open in IMG/M |
| 3300031782|Ga0318552_10173903 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300031795|Ga0318557_10126170 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300031797|Ga0318550_10344449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300031798|Ga0318523_10202669 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300031799|Ga0318565_10580381 | Not Available | 539 | Open in IMG/M |
| 3300031805|Ga0318497_10652724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300031832|Ga0318499_10152809 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031833|Ga0310917_10644711 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031879|Ga0306919_10419790 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300031897|Ga0318520_10368244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J367 | 874 | Open in IMG/M |
| 3300031897|Ga0318520_10458918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J367 | 783 | Open in IMG/M |
| 3300031910|Ga0306923_10102647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3228 | Open in IMG/M |
| 3300031945|Ga0310913_10681231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300031947|Ga0310909_11272498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300031954|Ga0306926_10802267 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300031959|Ga0318530_10076450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1303 | Open in IMG/M |
| 3300032009|Ga0318563_10365250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J367 | 781 | Open in IMG/M |
| 3300032010|Ga0318569_10438376 | Not Available | 609 | Open in IMG/M |
| 3300032076|Ga0306924_10116418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3037 | Open in IMG/M |
| 3300032090|Ga0318518_10439487 | Not Available | 668 | Open in IMG/M |
| 3300032091|Ga0318577_10618317 | Not Available | 514 | Open in IMG/M |
| 3300032094|Ga0318540_10565036 | Not Available | 548 | Open in IMG/M |
| 3300033289|Ga0310914_11304048 | Not Available | 628 | Open in IMG/M |
| 3300033290|Ga0318519_10645956 | Not Available | 645 | Open in IMG/M |
| 3300033550|Ga0247829_11693902 | Not Available | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.00% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_11905903 | 2228664022 | Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLGAKAIAKLKGYEF |
| ICChiseqgaiiDRAFT_08414051 | 3300000033 | Soil | MPRGVVVVYFSRFGKPLQXHHKVVLDLGAKAIAKIKGYEFGGHYDTAHHYSGPLFFVP |
| AF_2010_repII_A1DRAFT_101105704 | 3300000597 | Forest Soil | MANGVVVLYVSQFDKSLQWHHKVVLDAVAKAIAKIKRYDFG |
| Ga0066396_100564083 | 3300004267 | Tropical Forest Soil | MARGVVVVYFSRFGKPLQRHHKVVLDLNAKAIAKIKRYEFGGHY |
| Ga0066395_102067741 | 3300004633 | Tropical Forest Soil | MDEGSITMANGTVVLYFSRFGKPLQTHHKVVLDLGAKAIAKLKG |
| Ga0066388_1024248362 | 3300005332 | Tropical Forest Soil | VATGTVVTYFSRFGKPLQLHHKAVLDLGAKAIARIVGYEFG |
| Ga0066388_1050492803 | 3300005332 | Tropical Forest Soil | MANGIVVLYVSRFGKPLQAHHKVVLDLGAKAIAKIKGYKF |
| Ga0066388_1085968811 | 3300005332 | Tropical Forest Soil | MANGVVVLYFSQFDKSLQWHHKVVLDAVAKAIAKIKRYDFGG |
| Ga0066692_101100154 | 3300005555 | Soil | VHARLTIMANGIVVLYFSRFGKPLQTHHKVVLDLGA |
| Ga0066654_104119704 | 3300005587 | Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLGAKAIAKLKGYEFGGHYDAAYGYSGPL |
| Ga0066903_1064453251 | 3300005764 | Tropical Forest Soil | MANGVVVLYFSHFDKLLQWHHKVVLDATAKAIAKIKHYDFGGQYEGAV* |
| Ga0081540_11951091 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MTRGVVVVYFSGLGEPLQWHHKVVVDANAKAIAKIKGYAFKGRHEEG |
| Ga0066652_1019949922 | 3300006046 | Soil | MASGNVDIYFSPFGKPLQTHHQIVLDLAAKAIAKI |
| Ga0075417_106380523 | 3300006049 | Populus Rhizosphere | MARGLVVVCSSRFGKPLQWHHKVVLDLGAKAIARIKGYDFGGHYDT |
| Ga0075417_106400232 | 3300006049 | Populus Rhizosphere | MPRGVVVVYFSQFGKPLQAHHKVVLDLGAKAIAKIKGYDFGGHY |
| Ga0075018_102147951 | 3300006172 | Watersheds | MANGTVVLYFSRFGKPLQWHHKVVLDLDAKAIAGIKGYKFGGLYDPEHNYSGPLFF |
| Ga0075431_1005648033 | 3300006847 | Populus Rhizosphere | MARGLVVVCSSRFGKPLQWHHKVVLDLGAKAIARIKGYEFGGHYDTA |
| Ga0075425_1023672511 | 3300006854 | Populus Rhizosphere | MDEGSITMARGVVVVYFSRFGKPLQTHHKVVLDLGAKAI |
| Ga0075418_113715021 | 3300009100 | Populus Rhizosphere | MARGVVVVYLSWFGKPLQRHHKVVLHAGSRAIANIK |
| Ga0126373_117849941 | 3300010048 | Tropical Forest Soil | MANGTVVLYVSRFGKPLQAHHKVVLDLNAKAIAKL |
| Ga0126373_128197721 | 3300010048 | Tropical Forest Soil | MKDRLPMARGVVVVYFSRFGKPLQRHHKVVLDLNAKAIAK |
| Ga0126376_124547661 | 3300010359 | Tropical Forest Soil | MANGTVVLYVSRFGKPLQAHHKVVLDLNAKAIAKLKGCKFGGRYDPEHNYSGPLFF |
| Ga0126372_113573122 | 3300010360 | Tropical Forest Soil | MDEGSITMANGTVVLYVSRFGKPLQTHHKVVLDLGAKAIA |
| Ga0126372_132087591 | 3300010360 | Tropical Forest Soil | MARGVVMVYFSRFGKPLQTHHKAVLDLGAKAIAKIKGYKFGGHYD |
| Ga0126378_107724243 | 3300010361 | Tropical Forest Soil | MANGTVVLYVSRFGKPLQTHHKVVLELDAKAIASIKGYKFGGRYYPEHN |
| Ga0126378_115325282 | 3300010361 | Tropical Forest Soil | MDEGSIIMATGVVVVYFSQFGKPLQTHHKVVLDLDAKAIA |
| Ga0126379_118560161 | 3300010366 | Tropical Forest Soil | MASGNVLIYFSRFGKPLQTHHKVVLDLATKAIARING |
| Ga0126379_125229852 | 3300010366 | Tropical Forest Soil | MPSGVAVVYFSRFGKPLQAHHKVVLDLGAKAIAKLKGYEFGG |
| Ga0126379_128388831 | 3300010366 | Tropical Forest Soil | MANGIVLLYFSRFGKPLQAHHKAVLDSDAKAIAKIKGYEFGGHY |
| Ga0126381_1048545901 | 3300010376 | Tropical Forest Soil | MTVANGVVVVYLSRFGKPMQWHHKVVLDAGAKAIAKIKGYD |
| Ga0120191_100398341 | 3300012022 | Terrestrial | MARGVVVIYFSWFGKPLQRHHKVVLDAGSKAIANIKGYD |
| Ga0137364_111323481 | 3300012198 | Vadose Zone Soil | LIAVTRGVVVVYFSRFGKPLQWHHKVVLESSAKTIAAIKG |
| Ga0137382_105650491 | 3300012200 | Vadose Zone Soil | MPRGLVVVYFSRFGKPLQAHHKAVLDLNAEAIAQIKGYKFGGHYDTANDYS |
| Ga0137365_109666822 | 3300012201 | Vadose Zone Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLGAKAIARI |
| Ga0137379_106987211 | 3300012209 | Vadose Zone Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLDAKAIARMKGYKFGGPYDPEHNYSGPL |
| Ga0137378_112134781 | 3300012210 | Vadose Zone Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLGAKAIARIKGYKF |
| Ga0137384_104985251 | 3300012357 | Vadose Zone Soil | MARGVVVVYFSWFGKPLQWHHKVVLDLGAKAIAKIKG |
| Ga0137360_113975481 | 3300012361 | Vadose Zone Soil | MANGIVVLYFSRFGKPLQWHHKVVLDLGAKAIARIKGHKFG |
| Ga0137360_117634492 | 3300012361 | Vadose Zone Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLDAKAIARIKGYKFG |
| Ga0137361_109968172 | 3300012362 | Vadose Zone Soil | MANGIVVLYFSRFGKPLQWHHKVVLDLGAKAIARIKGHKFGGLYDPEHNYSG |
| Ga0137359_117643872 | 3300012923 | Vadose Zone Soil | MANGIVVLYFSRFGKPLQRHHKVVLDLGAKAIAKLKGYEF |
| Ga0164306_105048771 | 3300012988 | Soil | MANGNVVIYSSRFGKPLQTHHKVVLELAAQTIAKIKAYDFGGNYDPA |
| Ga0164305_102067861 | 3300012989 | Soil | MPRGVVVVYFSRFGKPLQAHHKVVLDLGAKAIAKIKGYEFGGHYDTAHHYSGPLF |
| Ga0182041_106694162 | 3300016294 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLDAKAIASIKGYEFGGPYDP |
| Ga0182038_111715872 | 3300016445 | Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLGAKAIAKLKGYEFGGHYDA |
| Ga0184608_100177371 | 3300018028 | Groundwater Sediment | MANGNVVIYFSRFGKPLQTHHKVVLDLAARTIAKIKGYDFG |
| Ga0190270_100016381 | 3300018469 | Soil | MASGNVLIYFSRFGKPLQTHHKIVFNLAAKTIAKIKGYDFGGHYDTARDY |
| Ga0193730_11682981 | 3300020002 | Soil | MASGNVLIYFSRFGKPLQTHHKVVLDLAARTIAKIKG |
| Ga0210381_102185941 | 3300021078 | Groundwater Sediment | MAIGNVLIYFSRFGKPLQTHHKIVLNLAAETIAKIKGY |
| Ga0210382_102547151 | 3300021080 | Groundwater Sediment | MANGNVVIYFSRFGKPLQTHHKVVLDLAARTIAKIKGYD |
| Ga0213878_100934263 | 3300021444 | Bulk Soil | MVDGTVVLYVSRFGKPLQTHHKVVLGLDAKAIAKLKGY |
| Ga0126371_107383553 | 3300021560 | Tropical Forest Soil | MDEGSITMANGTVVLYFSRFGKPLQTHHKVVLDLGAKAIAKLK |
| Ga0126371_127405951 | 3300021560 | Tropical Forest Soil | MANGVVVLYVSQFDKSLQWHHKVVLDTVAKTIAKIKRYDF |
| Ga0126371_129164571 | 3300021560 | Tropical Forest Soil | MDEGSITMANGTVVLYFSRFGKLLQMHHKVVLELDAKAI |
| Ga0126371_132948791 | 3300021560 | Tropical Forest Soil | MANGTVVLYVSRFGKPLQAHHKVVLDLNAKAIAKLK |
| Ga0193698_10235822 | 3300021968 | Soil | MASGNVLIYFSRFGKPLQTHHKIVLNLAAETIAKIKGYDFGGHYDTARDYPGPL |
| Ga0207693_112273902 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VARGVVVVYFSRFGKPLQWHHRVVLESGAKATAAILGYEFAGRYERPGDH |
| Ga0207700_102486491 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VHARLTIMANGIVVLYFSRFGKPLQTHHKVVLDLGAKAI |
| Ga0207664_112584803 | 3300025929 | Agricultural Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLGAKAIAKLKG |
| Ga0209239_10332391 | 3300026310 | Grasslands Soil | VHARLTIMANGIVVLYFSRFGKPLQTHHKVVLDLGAKAIAKLKGYEFGGHYDA |
| Ga0209622_10123431 | 3300027502 | Forest Soil | MARGVVVVYFSWFGKPLQWHHKVVLDLDAKAIARIKGYKFGGPYDPEHN |
| Ga0209684_10663001 | 3300027527 | Tropical Forest Soil | MARGVVVVYFSRFGKPLQRHHKVVLDLNAKAIAKIKRYEF |
| Ga0209465_100688131 | 3300027874 | Tropical Forest Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLDAKAIASIKGYEFG |
| Ga0137415_104911551 | 3300028536 | Vadose Zone Soil | MANGTVVLYFSRFGKPLQWHHKVVLDLGAKAIARIKGHKFGGLYDPEHNY |
| Ga0307278_105561452 | 3300028878 | Soil | MANGNVVIYFSRFGKPLQMHHKVVLDLAARTIAKIKGYDFGGNYDPARDYPGPLYFVPD |
| Ga0318573_103963832 | 3300031564 | Soil | MANGTVVLYASRFGKPLQTHHKVVLDLNAKAIARIKGYKFE |
| Ga0310915_108415971 | 3300031573 | Soil | MDEGSIIMATGVVVVYFSRFGKPLQTHHKVVLGLDAKAIAKLKGYKFGGHY |
| Ga0318561_102809372 | 3300031679 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLDAKAIASIKGYKFE |
| Ga0318501_107938601 | 3300031736 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLNAKAIASIKGYKFEGPYDPEHNYSGPLFF |
| Ga0306918_115451532 | 3300031744 | Soil | MANGIVVLHFSRFGKPLQTHHKAVLDLDAKAIAKI |
| Ga0318492_105340241 | 3300031748 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLDAKAIARIKGYK |
| Ga0318526_101612451 | 3300031769 | Soil | MDEGSITMATGVVVVYFSRFGKPLQTHHKVVLDLGAKSIAKIKGYDFSGHYESG |
| Ga0318521_105865053 | 3300031770 | Soil | MTNGIVVLYSSRFGKPLQTHHKVVLDLDAKAIARIKGYEFGGPYDPEHNY |
| Ga0318521_108668791 | 3300031770 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLDAKAIASIKGYKFGGPYDPEYN |
| Ga0318546_113060232 | 3300031771 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLNAKAIASIKGYK |
| Ga0318552_101739031 | 3300031782 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLDAKAIASIKGYKFGGPYDPEYNYSG |
| Ga0318557_101261701 | 3300031795 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLDAKAIARIKGYKFGGPYDPEHNY |
| Ga0318550_103444491 | 3300031797 | Soil | MATGVVVVYFSRFGKPLQTHHKVVLDLGAKAIAKLKGYKFGGAYDPEHSY |
| Ga0318523_102026692 | 3300031798 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLDAKAIARIKGYK |
| Ga0318565_105803811 | 3300031799 | Soil | MATGVVVVYFSRFGKPLQTHHKVVLDLGAKAIAKLKGYK |
| Ga0318497_106527242 | 3300031805 | Soil | MDEGSITMATGVVVVYFSRFGKPMQWHHKVVLNAGAKAIAKIK |
| Ga0318499_101528092 | 3300031832 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLNAKAIASIK |
| Ga0310917_106447111 | 3300031833 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLDAKAIAGIKGYKFGGPYDPEH |
| Ga0306919_104197902 | 3300031879 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLNAKAIASIKGYKFEGRYDPEHN |
| Ga0318520_103682441 | 3300031897 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLNAKAIASIKGYKFEGPYDPEHNY |
| Ga0318520_104589181 | 3300031897 | Soil | MTNGIVVLYSSRFGKPLQTHHKVVLDLDAKAIARIKGYE |
| Ga0306923_101026474 | 3300031910 | Soil | MANGTVVLYASRFGKPLQTHHKVVLDLNAKAIARIKG |
| Ga0310913_106812311 | 3300031945 | Soil | MATGVVVVYFSRFGKPLQTHHKVVLDLGAKAIAKLKGYKFGGAYDPEHSYSGPLFF |
| Ga0310909_112724982 | 3300031947 | Soil | MPRGVVVVYFSRFGKPLQAHHKVVLDLNAKAIAKIK |
| Ga0306926_108022672 | 3300031954 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLDAKAIAGIK |
| Ga0318530_100764501 | 3300031959 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLDAKAIASIK |
| Ga0318563_103652501 | 3300032009 | Soil | MANGIVVLYFSRFGKPLQTHHKAVLDSDAKAIAKIKGYEFGGHYDTAHD |
| Ga0318569_104383762 | 3300032010 | Soil | MANGTVVLYASRFGKPLQTHHKVVLDLNAKAIARIK |
| Ga0306924_101164181 | 3300032076 | Soil | MANGIVVLYFSRFGKPLQTHHKVVLDLDAKAIARIKGYKFGGLYDPEHNYSS |
| Ga0318518_104394871 | 3300032090 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLNAKAIASIKGYKFEGPYDPEHNYSGPLFF |
| Ga0318577_106183171 | 3300032091 | Soil | MANGTVVLYASRFGKPLQTHHKVVLDLNAKAIARIKGYKFEGPYDPE |
| Ga0318540_105650361 | 3300032094 | Soil | MANGTVVLYFSRFGKPLQTHHKVVLDLNAKAIASIKGYKFEG |
| Ga0310914_113040481 | 3300033289 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLNAKAIASIKGYKFEGPYDPEHNYS |
| Ga0318519_106459561 | 3300033290 | Soil | MANGTVVLYVSRFGKPLQTHHKVVLDLDAKAIASIKGYKFEGPYDPDHS |
| Ga0247829_116939022 | 3300033550 | Soil | MASGNVLIYFSRFGKPLQTHHKIVFNLAAKTIAKIKGYDFGGHYDTARDYSGPLYF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |