| Basic Information | |
|---|---|
| Family ID | F105804 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LAGVKTVLLQGQRPRAKRVEFPLIVSDGPKVDLTNEQIYEHVEFP |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 9.00 % |
| % of genes from short scaffolds (< 2000 bps) | 8.00 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (92.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.44% β-sheet: 0.00% Coil/Unstructured: 83.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01850 | PIN | 66.00 |
| PF02803 | Thiolase_C | 2.00 |
| PF05985 | EutC | 2.00 |
| PF02012 | BNR | 1.00 |
| PF12704 | MacB_PCD | 1.00 |
| PF07676 | PD40 | 1.00 |
| PF02321 | OEP | 1.00 |
| PF01381 | HTH_3 | 1.00 |
| PF00128 | Alpha-amylase | 1.00 |
| PF00589 | Phage_integrase | 1.00 |
| PF05656 | DUF805 | 1.00 |
| PF01909 | NTP_transf_2 | 1.00 |
| PF15937 | PrlF_antitoxin | 1.00 |
| PF01546 | Peptidase_M20 | 1.00 |
| PF05598 | DUF772 | 1.00 |
| PF13635 | DUF4143 | 1.00 |
| PF13561 | adh_short_C2 | 1.00 |
| PF02604 | PhdYeFM_antitox | 1.00 |
| PF00989 | PAS | 1.00 |
| PF00072 | Response_reg | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 2.00 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 2.00 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.00 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.00 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.00 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.00 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 1.00 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 92.00 % |
| All Organisms | root | All Organisms | 8.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004631|Ga0058899_10071695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300005559|Ga0066700_10548552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300006893|Ga0073928_10271798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1286 | Open in IMG/M |
| 3300012362|Ga0137361_11789171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300019260|Ga0181506_1316090 | Not Available | 528 | Open in IMG/M |
| 3300021181|Ga0210388_10017393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5774 | Open in IMG/M |
| 3300027748|Ga0209689_1222607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300028828|Ga0307312_10589571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 735 | Open in IMG/M |
| 3300034177|Ga0364932_0184474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.00% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.00% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300027023 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10350951 | 3300000651 | Forest Soil | ELILLGVRVTLAEGKRPRSRRVKFPLIVSVGPKVDLTNEQIYEHVEFP* |
| JGI20193J14888_10441222 | 3300001385 | Arctic Peat Soil | AGVKTVLVEGQRPRPQRIQFPLIVSKGRKVNVTNEQIHEHIEFP* |
| Ga0058899_100716952 | 3300004631 | Forest Soil | SIRELVLLGVRRVVLQAQRPRPKRVEFPLIVSKGPQVDLTNEQIYEHVEFP* |
| Ga0066688_101632461 | 3300005178 | Soil | IRELVLLGVRRVVLQAQRPRPKRVEFPLIVSKGPQVDLTNEQIYEHVEFP* |
| Ga0066675_111344032 | 3300005187 | Soil | ELILLGVRVTLIEGKRPRSKRVKFPLIASDGPKVDLTNEQIYEHVEFP* |
| Ga0066388_1086152851 | 3300005332 | Tropical Forest Soil | RELVLAGVRTVLLQGHRPRPKQVIFPLIVSKGPKVNVTNEQIYEHVEFP* |
| Ga0070711_1009968802 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ELILLGVRVTLIEGKRPRSKRVKFPLIASDGPKVDLTNEQIYEHIEFP* |
| Ga0070695_1016989911 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGVRVTLVEGKHPRARRVKFPLIVSDGPKVELTNEQIYEHIEFP* |
| Ga0066700_105485521 | 3300005559 | Soil | QGRSIRELILLGVRVTLVEGKRPRSRRVKFPLIVSDGPKVDVTNEQIYEHLEFP* |
| Ga0070763_100728714 | 3300005610 | Soil | LLEGKRPRAKRVRFPLIISKGPKVELTNEQIYERIEFP* |
| Ga0066696_100532911 | 3300006032 | Soil | VKDKHPRSARVKVPVIVSDAPKVDLTNEPIYEHVEFP* |
| Ga0075018_104579272 | 3300006172 | Watersheds | LLGVRVTLIEGKRPRAKRVKFPLIASDGPKVDLTNEQIYEHIEFP* |
| Ga0075520_14544472 | 3300006795 | Arctic Peat Soil | AGVKTVLVEGQRPPSHKVRFPLIVSRGPKVDVTNERIYEHVEFP* |
| Ga0075425_1031225842 | 3300006854 | Populus Rhizosphere | ILLGVRVTLIEGKRPRSKRVKFPLIASDGPKVDLTNEQIYEHIEFP* |
| Ga0073928_102717983 | 3300006893 | Iron-Sulfur Acid Spring | SIRELVLLGVRRVVLQAQRPRPKRVEFPLIVSKGPPVDLTNEQIYEHVEFP* |
| Ga0073928_111148672 | 3300006893 | Iron-Sulfur Acid Spring | VVLQAQRPRPKRVEFPLIVSKGPPVDLTNEQVYEHIEFP* |
| Ga0099829_104646433 | 3300009038 | Vadose Zone Soil | LGVRVTLIEGKRPRSNRVKFPLIASDEPKVDLTNEQIYEHIEFP* |
| Ga0099830_115403972 | 3300009088 | Vadose Zone Soil | RSVRELVLAGVKTVLVQGQRPRPKRVQFPLIVSDGPKVDLTNEQIYEHVEFP* |
| Ga0099827_110337842 | 3300009090 | Vadose Zone Soil | RELILLGVRVTLIEGKRPRSKRVKFPLIASDGPKVDLTNEQIYEHIEFP* |
| Ga0116120_12939701 | 3300009641 | Peatland | SVRELVLAGVKTVLLQGQRPRPKRVQFPLIVSDGPKVDLTNEQIYEHVEFP* |
| Ga0127486_11700103 | 3300010128 | Grasslands Soil | RSIRELILLGVRVTLIEGKRPRAKRVKFPLIASDGPKVDLTNEQIYEHVEFP* |
| Ga0127483_10798171 | 3300010142 | Grasslands Soil | VTLIEGKRPRAKRVKFPLIASDGPKVDLTNEQIYEHVEFP* |
| Ga0136449_1024385543 | 3300010379 | Peatlands Soil | LLEGKRPRPKRVRFPLIASRGPKVDLTNEHIYEHVEFP* |
| Ga0150983_111795212 | 3300011120 | Forest Soil | LIEGKRPRAKRVKFPLIASDGRKVDLTNEQIYEHVEFP* |
| Ga0137360_102429501 | 3300012361 | Vadose Zone Soil | SIRELILLGVRVTLIEGKRPRSKRVKFPLIASDGPKVDLTNEQIYEHIEFP* |
| Ga0137361_117891711 | 3300012362 | Vadose Zone Soil | QGRSIRELILLGVRVTLIEGKRPRSKRVEFPLIASDGPKVDLTNEQIYEHIEFP* |
| Ga0137395_111186572 | 3300012917 | Vadose Zone Soil | SIRELILLGVRVTLIEGKRPRSNRVKFPLIASDGPKVDLTNEQIYEHIEFP* |
| Ga0126369_136295471 | 3300012971 | Tropical Forest Soil | ILMGVRVTLVEGKRPRSHRVKFPLIVSDGPKVDLTNEQIYEHLEFP* |
| Ga0182016_102169521 | 3300014493 | Bog | LLQGQRPRAKRVQFPLIVSSGPKVDLTNEQIYEHVEFP* |
| Ga0182036_106968931 | 3300016270 | Soil | ELILLGVRVTLVEGKRPRSGRVKFPLIVSDGPKVDLTNEQIYEHIEFP |
| Ga0182033_106335831 | 3300016319 | Soil | GVRVTLVEGKRPRSGRVKFPLIVSDGPKVDLTNEQIYEHIEFP |
| Ga0182032_104060033 | 3300016357 | Soil | LAGVRTVLLEGQRPHAKKVQFPLIVSEGAKVNVTNEQIYEHVEFP |
| Ga0182032_119485032 | 3300016357 | Soil | RVTLVEGKRPRSGRVKFPLIVSDGPKVDLTNEQIYEHIEFP |
| Ga0182038_114346551 | 3300016445 | Soil | GHRPRPKQVIFPLIVSKGPKVNVTNQQIYEHVEFP |
| Ga0181511_13822371 | 3300016702 | Peatland | LAGVKTVLLQGQRPRAKRVEFPLIVSDGPKVDLTNEQIYEHVEFP |
| Ga0187825_102394113 | 3300017930 | Freshwater Sediment | GVCSVLVEGQRPRSKRVKFPLIISEGPKVELTYEQIYEAC |
| Ga0187819_103410561 | 3300017943 | Freshwater Sediment | QGERPRPRRVRFPLIVSEGPKVDVTNEQIYEYVEFP |
| Ga0187879_105191792 | 3300017946 | Peatland | RELVLAGVKTVLLQGQRPRAKRVEFPLIVSDGPKVDLTNEQIYEHVEFP |
| Ga0187857_100713421 | 3300018026 | Peatland | VLLKSERPRPKRARFPLITSKGPKVNVTSEQIYEHVEFP |
| Ga0187857_101572663 | 3300018026 | Peatland | VQGQRPKRVQFPLVVSNGAKVDLTNEQVYKQVGFP |
| Ga0187887_105874302 | 3300018043 | Peatland | VRELVLAGVKNVLLQAHRPRARRVKFPIIVSEDPKVHLTNEQIYGDTFP |
| Ga0187851_106173591 | 3300018046 | Peatland | IRELILLGVRVTLIEGKRPRTKRVKFPLIASDGPKVDLSNQKIYEHIEFP |
| Ga0187784_100403091 | 3300018062 | Tropical Peatland | IRELILLGVRVTLVEGKRPRSRRVKFPLIVSDGPKVDLTNEQIYEHLEFP |
| Ga0187771_118528992 | 3300018088 | Tropical Peatland | LAGVQASLLEPKRPRARRVRFPLLVSPGPKVEITNEQIYEHVEFP |
| Ga0066669_100997553 | 3300018482 | Grasslands Soil | MRDLVLAGVRSVLLPGRRPRARVQFPLIVSEGPKINLTNEQIYES |
| Ga0181506_13160901 | 3300019260 | Peatland | LLQARRPRPQRVQFTLIVSSGPKVDLTNEQIYEHRS |
| Ga0210407_102985843 | 3300020579 | Soil | LQAQRPRPKRVEFPLIVSKGPPVDLTNEQIYEHVEFP |
| Ga0210405_114287461 | 3300021171 | Soil | GSVREFILACVKTTLLQGKPPRTKRVHFPLIVSRGPKVNLTNEQIHERVEFP |
| Ga0210388_100173936 | 3300021181 | Soil | GCSIRELVLLGVRRVVLQAQRPRPKRVEFPLIVSKGPPVDLTNEQIYEHVEFP |
| Ga0210393_109549273 | 3300021401 | Soil | TVLLQGQRPRPKRVRFPLIVSKGPKVNVTNEGIYEHVEFP |
| Ga0210397_107222933 | 3300021403 | Soil | IEGKRPRSKRVKFPLIASDGPKVDLTNEQIYEHIEFP |
| Ga0210392_102559961 | 3300021475 | Soil | ILLGVRVTLIEGNRPRSKRVKFPLIASDGPKVDLTNEQIYEHIEFP |
| Ga0210398_100940445 | 3300021477 | Soil | VRRVVLQAQRPRPKRVEFPLIVSKGPPVDLTNEQIYEHVEFP |
| Ga0210402_107267861 | 3300021478 | Soil | SVQALVLAAIERALLQNQRPQAVRVQFPPIVSDGPRVDLTNEQIYRQVEF |
| Ga0210409_105088111 | 3300021559 | Soil | VRELVLSGVRSVLLDAQRPPAKKVQFPLIVSKGPKVNVTNDQIYEHVEFP |
| Ga0210409_115381262 | 3300021559 | Soil | ALLESKRPKAKRVQFPLIVSQGPKVDLTNEQIYERVEFP |
| Ga0209619_104991802 | 3300025159 | Soil | GVRSVLLQGQRPRPKRGRFPLIVSDGPKVDLRNEQIYEHVEFP |
| Ga0208936_10019474 | 3300025404 | Peatland | RCERELGARLVLAGVQSVLLQARRPRPKRVQFPLIASSGPKVDLTNEQMYEHVEFP |
| Ga0207665_107230853 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IRELILLGVRVTLIEGKHPRTKRVKFPLIVSDGPKVDLTNEQIYEHIEFP |
| Ga0207665_108460321 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EGKRPRAKRVKFPLIASDGPKVDLTNEQIYEHIEFP |
| Ga0209027_10088087 | 3300026300 | Grasslands Soil | GVRVTLIEGKRPRSKRVKFPLIATDEPKVDLTNEQIYEHIEFP |
| Ga0209156_100578372 | 3300026547 | Soil | ELILLGVRVTLIEGKRPRAKRVKFPLIASDGPKVDLTNEQIYEHVEFP |
| Ga0209577_103098481 | 3300026552 | Soil | RVSLVKDKHPRSARVKFPVIVSDAPKVDFTNEPIYEHVEFP |
| Ga0179587_101772603 | 3300026557 | Vadose Zone Soil | VRVTLAEGKRPRAKRIKFPLIVSDGPKVNLTNEEIYEHVEFP |
| Ga0207787_10311932 | 3300026908 | Tropical Forest Soil | LLGVRVTLVEGKRPRSRRVKFPLIVSDGPKVELTNEQIYEHLEFP |
| Ga0207736_1124392 | 3300027023 | Tropical Forest Soil | VTLVEGKRPRSRRVKFPLIVSDGPKVELTNEQIYEHLEFP |
| Ga0207826_12084511 | 3300027680 | Tropical Forest Soil | RELILLGVRVTLVEGKRPRSGRVKFPLIVSDGPKVDLTNEQIYEHLEFP |
| Ga0209178_11372321 | 3300027725 | Agricultural Soil | LVEGKRPRSRRVKFPLIVSDGPKVDLTNEQIYEHIEFP |
| Ga0209689_12226073 | 3300027748 | Soil | QGRSIRELILLGVRVTLVEGKRPRSRRVKFPLIVSDGPKVDVTNEQIYEHLEFP |
| Ga0209772_102867361 | 3300027768 | Bog Forest Soil | LLQGQRPRQKRVQFPLIVSEGPKVHLTNEQIYEHVEFP |
| Ga0209656_101771453 | 3300027812 | Bog Forest Soil | MLAEGQRAASHRVQFPLIVSRGPKVKVTNLQIYDHVEFP |
| Ga0209590_103541281 | 3300027882 | Vadose Zone Soil | REVILAGARRTLVEGKRPRPKRVRFPLIVSKGPKVDLTNEQIYENVEFP |
| Ga0209380_100481333 | 3300027889 | Soil | TVLLQGQRPRSKRVRFPLIVSEGPKVNVTSENIYEHVEFP |
| Ga0209488_107720932 | 3300027903 | Vadose Zone Soil | QARRPRRKRVQFPLIVSTGPKVDLTNEQIYEHVEFP |
| Ga0302224_101214871 | 3300028759 | Palsa | QAQRPRPKRIKFPLIVSKGPQVDLTNEQIYEHVEFP |
| Ga0307312_105895713 | 3300028828 | Soil | SIRELVLVGVESVLLRRQRPRSRTVKFPLIVSSGPKVNLTNDQIYEHVEFP |
| Ga0311352_113224752 | 3300029944 | Palsa | GVQSVLLQARRPRPKRVQFPLIVSHGPNVDLTNEQMYEHVEFP |
| Ga0311339_119106822 | 3300029999 | Palsa | QSVLLQARRPRPKRVQFPLIVSHGPKVDLTNEQMYEHVEFP |
| Ga0311355_106489493 | 3300030580 | Palsa | VLQAQRPRPKRVQFPLIVSTGPQVDLTNEQIYEHVEFP |
| Ga0311354_118299481 | 3300030618 | Palsa | LVLAGVQSVLLQARRPRPKRVQFPLIVSQGPKVDLTNEQMYEHVEFP |
| Ga0075388_113962911 | 3300030848 | Soil | RVTLIEGKRPRSKMVKFPLIASDGPKVDLTNEQIYEHIEFP |
| Ga0302180_101443993 | 3300031028 | Palsa | GIRTVLLQGQRPRPRRVQFPLIVADGPKVVLTNEQIYEHVEFP |
| Ga0265760_101432983 | 3300031090 | Soil | VVLQAQRPRPRRVEFPLIVSKGPLVDLTNEQIYEHVEFP |
| Ga0265760_103324113 | 3300031090 | Soil | LQAQRPRPKRVEFPLIVSKGPPVDLTNEQIYEHIEFP |
| Ga0247727_111834492 | 3300031576 | Biofilm | IQRALLDAKRPKAKRVRFPIIVSARKGPKLILTNEQIYEYVEFP |
| Ga0310686_1038347814 | 3300031708 | Soil | LILLGVRVTLIEGKRPRTKRVKFPLIASDGPKVDLTNEQIYEHIEFP |
| Ga0318497_104343123 | 3300031805 | Soil | VLLEGQRPRSKKVQFPLIVSEGAKVNVTNEQIYEHVEFP |
| Ga0310917_108545801 | 3300031833 | Soil | LAGVRTVLLEGQRPRAKKVQFPLIVSEGTKVNVTNEQIYEHVEFL |
| Ga0306925_119533871 | 3300031890 | Soil | RELVLAGVRTVLLEGQRPRPKKLQFPLIVSKGPKVDVTNEQIYEHVEFP |
| Ga0310916_108241991 | 3300031942 | Soil | LLEGQRPHAKKVQFPLIVSEGAKVNVTNEQIYEHVEFP |
| Ga0310913_105790461 | 3300031945 | Soil | IRELVLAGVRTVLLEGQRPHAKKVQFPLIVSEGAKVNVTNEQIYEHVEFP |
| Ga0307479_105829641 | 3300031962 | Hardwood Forest Soil | RKHPRMKRVSFPLIVSKGPKVEMSNERIYERAQIP |
| Ga0307479_106582841 | 3300031962 | Hardwood Forest Soil | GVKTTLLEAKRPRAKKVRFPLIVSRGPKVDLTNEQIYEHVEFP |
| Ga0311301_127124041 | 3300032160 | Peatlands Soil | LLGINNSLLQSKRPRPKRVRFPLIVSRGPKVDLTNEKIYEHVEFP |
| Ga0307470_115664712 | 3300032174 | Hardwood Forest Soil | LQGQRPRAKRVRFPLIVSEGPKVDVTNEKIYERVEFP |
| Ga0335079_108167811 | 3300032783 | Soil | VLAGVKTVLLEGRRPRARRVQFPLIVSKGPKVNVTNEQIYEHVEFP |
| Ga0335072_117435901 | 3300032898 | Soil | SVRGLVLAGVKSVLLQSRRPRPKRVRFPLIVSKGPKVNLTNEQIYERVEFP |
| Ga0326726_116244491 | 3300033433 | Peat Soil | VRELVLAGVKTVLLQGQRPRPKRVQFPLIVSDGPKVDLTNEQVYEHVEFP |
| Ga0326724_0399275_2_124 | 3300034091 | Peat Soil | TVLLQGQRPRPKRVQFPLIVSDGPKVDLTSEQIYEHVEFP |
| Ga0364932_0184474_637_792 | 3300034177 | Sediment | SVRELILAGVRTTLLDSQRPRPKRVRFPLIMSRGPKVTLTNQQIYEHVEFP |
| ⦗Top⦘ |