| Basic Information | |
|---|---|
| Family ID | F105801 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 55.56 % |
| % of genes near scaffold ends (potentially truncated) | 6.00 % |
| % of genes from short scaffolds (< 2000 bps) | 6.00 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.21% β-sheet: 0.00% Coil/Unstructured: 62.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00216 | Bac_DNA_binding | 7.00 |
| PF03401 | TctC | 3.00 |
| PF08734 | GYD | 3.00 |
| PF13356 | Arm-DNA-bind_3 | 2.00 |
| PF03562 | MltA | 1.00 |
| PF00027 | cNMP_binding | 1.00 |
| PF11146 | DUF2905 | 1.00 |
| PF12706 | Lactamase_B_2 | 1.00 |
| PF04392 | ABC_sub_bind | 1.00 |
| PF01435 | Peptidase_M48 | 1.00 |
| PF13714 | PEP_mutase | 1.00 |
| PF10691 | DUF2497 | 1.00 |
| PF00589 | Phage_integrase | 1.00 |
| PF06629 | MipA | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 7.00 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.00 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 3.00 |
| COG2821 | Membrane-bound lytic murein transglycosylase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.00 |
| COG3713 | Outer membrane scaffolding protein for murein synthesis, MipA/OmpV family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.00 % |
| All Organisms | root | All Organisms | 2.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_104830708 | Not Available | 685 | Open in IMG/M |
| 3300005764|Ga0066903_100413931 | Not Available | 2227 | Open in IMG/M |
| 3300010376|Ga0126381_102615053 | Not Available | 722 | Open in IMG/M |
| 3300017822|Ga0187802_10003801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4433 | Open in IMG/M |
| 3300021560|Ga0126371_12198813 | Not Available | 666 | Open in IMG/M |
| 3300025898|Ga0207692_10560243 | Not Available | 731 | Open in IMG/M |
| 3300031573|Ga0310915_10000641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 16967 | Open in IMG/M |
| 3300031768|Ga0318509_10364792 | Not Available | 808 | Open in IMG/M |
| 3300031821|Ga0318567_10237017 | Not Available | 1023 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2NP_03318140 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | MKSLAIVTACALTLLSLSGCGCCNYVGKGKAPPPMARRPSR |
| AF_2010_repII_A01DRAFT_10088502 | 3300000580 | Forest Soil | MKVLALLTAVALTLTVAGCAQYSGPFLGKGKAPPPAAPVVTKG* |
| Ga0066388_1003065824 | 3300005332 | Tropical Forest Soil | MKTLVLAAAAALTLLSVAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0066388_1004817062 | 3300005332 | Tropical Forest Soil | MKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG* |
| Ga0066388_1009362371 | 3300005332 | Tropical Forest Soil | MKVLALLMAVALTLTVAGCAQYSGPFLGKGKAPPPAAPVVTKG* |
| Ga0066388_1019424001 | 3300005332 | Tropical Forest Soil | MKNLALATAAMLALLTIAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0066388_1048307083 | 3300005332 | Tropical Forest Soil | SMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG* |
| Ga0070713_1013549002 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLALVTAAALTLLSVAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0066708_102366981 | 3300005576 | Soil | MKALALVIAAALTLAGCAQYGGYYGKGKAPPPAAPVV |
| Ga0066903_1004139314 | 3300005764 | Tropical Forest Soil | MKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPA |
| Ga0066903_1008507551 | 3300005764 | Tropical Forest Soil | MKKLSLVMAAIVALLSVAGCAQYIGKGKTPPPVVTKG* |
| Ga0066903_1018416513 | 3300005764 | Tropical Forest Soil | MKVLALLTVVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG* |
| Ga0066903_1020901062 | 3300005764 | Tropical Forest Soil | MKTLVLAAAAALTLISVAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0066903_1027163033 | 3300005764 | Tropical Forest Soil | LALVIAAALTLAGCAQYGGYYGKGKAPPPAAPVVTKG* |
| Ga0066903_1069896371 | 3300005764 | Tropical Forest Soil | TKGGSMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG* |
| Ga0066903_1072758781 | 3300005764 | Tropical Forest Soil | VIAAALTLAGCAQYGGYYGKGKAPPPAAPVVTKG* |
| Ga0066903_1077720221 | 3300005764 | Tropical Forest Soil | MKVLAILTAAAVTLFSVAAYAQYGGYGAGPYYGKGKAPPP |
| Ga0066903_1087201452 | 3300005764 | Tropical Forest Soil | MKVLALLTAVALTLAGCAQYGGPLGKGKAPPPAAPVVTKG* |
| Ga0070717_113058402 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLALVTAAALALLSVAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0075026_1003541061 | 3300006057 | Watersheds | FVMTKEGAMKTLALVTAAALTLLSVAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0075017_1013607652 | 3300006059 | Watersheds | MKTLALVTAAALTLLTVAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0075018_104956221 | 3300006172 | Watersheds | VMTKEGAMKTLALVTAAALTLLSVAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0079222_108107893 | 3300006755 | Agricultural Soil | MKTLALVTAAALTLLSVAGCAQYVGKGKAPPPAAPVVTEG* |
| Ga0079221_116815902 | 3300006804 | Agricultural Soil | MTKEGALKTLALLTAAALTLLSVAGCAQYTGGPFGIGKGKAPPPAA |
| Ga0079220_102011271 | 3300006806 | Agricultural Soil | SIRSNIAFGSDKGAMKRLALVRASALTLLSVAGCAQYVGKGKAPPPAAPVVTKG* |
| Ga0126374_110668102 | 3300009792 | Tropical Forest Soil | MKALALVIAAALTLAGCAQYGGYYGKGKAPPPAAPVVTKG* |
| Ga0126373_112839492 | 3300010048 | Tropical Forest Soil | MKALALVIAAALTLAGCAQYGGGFYGKGKAPPPAAPVVTKG* |
| Ga0126373_118252091 | 3300010048 | Tropical Forest Soil | MKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG* |
| Ga0126373_120352691 | 3300010048 | Tropical Forest Soil | MKVLAILTAAAVTLFSVTAFAQYVGKGKAPPPVVTKG* |
| Ga0126370_102178984 | 3300010358 | Tropical Forest Soil | MTRESSMKNLALATAAMLALLTIAGCAQYVGKGKAPPPAAPVVTK |
| Ga0126370_104106933 | 3300010358 | Tropical Forest Soil | MKVLAILTAAAVTLFSVTAFAQYVGKGKAPPPVATKG* |
| Ga0126378_105885393 | 3300010361 | Tropical Forest Soil | HDKRRGAMKVLAILTAAAVTLFSVTAFAQYVGKGKAPPPVVTKG* |
| Ga0126381_1011406692 | 3300010376 | Tropical Forest Soil | VMTKGGSMKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG* |
| Ga0126381_1026150531 | 3300010376 | Tropical Forest Soil | AVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG* |
| Ga0126381_1031793711 | 3300010376 | Tropical Forest Soil | RVMTKGGSMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG* |
| Ga0126381_1041980671 | 3300010376 | Tropical Forest Soil | LALLTAAALTLLSVAGCAQYADGYYGKGKAPPPPVVSKG* |
| Ga0126383_103027412 | 3300010398 | Tropical Forest Soil | GAMKALALVIAAALTLAGCAQYGGYYGKGKAPPPAAPVVTKG* |
| Ga0126383_104018853 | 3300010398 | Tropical Forest Soil | MKALALVIAAALTLAGCAQYGGYYGKGKAPPPAAPVVTK |
| Ga0126369_117433502 | 3300012971 | Tropical Forest Soil | MKVLAILTAAAVTLFSVSAFAQYVGKGKAPPPVVTKG* |
| Ga0126369_121487632 | 3300012971 | Tropical Forest Soil | WRVMTKGGSMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG* |
| Ga0182036_115856531 | 3300016270 | Soil | MKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAA |
| Ga0182041_104822683 | 3300016294 | Soil | MKVLALLTAVALTLTVTGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0182033_102566962 | 3300016319 | Soil | MKVLVLLTAVALTLTVAGCAQYGGPFFGKGKAPPPA |
| Ga0182032_107845171 | 3300016357 | Soil | LALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0182040_114165183 | 3300016387 | Soil | RWFLLCHDKRRGAMKVLAILTAAAVTLFSVSAFAQYVGKGKAPPPVVTKG |
| Ga0187802_100038017 | 3300017822 | Freshwater Sediment | MKTLALVTAAALTLLTVAGCAQYVGKGKAPPPAAPVVTKG |
| Ga0187801_100424552 | 3300017933 | Freshwater Sediment | MKKLSLGMAAVLAILNIAGCAQYVGKGKAPPPAAPVVTKG |
| Ga0066669_103916121 | 3300018482 | Grasslands Soil | MTKGMTAMKKLSLGMAAVLALLRIAGYAQYIGKGKAPPPAAPVVTKG |
| Ga0210406_103986411 | 3300021168 | Soil | VVMTKEGAMKTLALVTAAALTLLTVAGCAQYVGKGKAPPPAAPVVTKG |
| Ga0126371_106469851 | 3300021560 | Tropical Forest Soil | MKVLAILTAAAVTLFSVTAFAQYVGKGKAPPPVATKG |
| Ga0126371_121988131 | 3300021560 | Tropical Forest Soil | MKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0207692_105602431 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLSIGMAVILALLSIAGCAQYVGKGKAPPPAAPVVTK |
| Ga0209473_12490871 | 3300026330 | Soil | MKALALLTAAALTLLSVAGCAQYADGYYGKGKAPPP |
| Ga0209474_105969762 | 3300026550 | Soil | MKALALVIAAALTLAGCAQYGGYYGKGKAPPPAAPVVTKG |
| Ga0209178_13569411 | 3300027725 | Agricultural Soil | LKTLALLTAAALTLLSVAGCAQYTGGPFGIGKGKAPPPAAPVV |
| Ga0209465_100534615 | 3300027874 | Tropical Forest Soil | MKVLALLTAVALTLTVAGCAQYSGPFLGKGKAPPPAAPVVTKG |
| Ga0209465_101114714 | 3300027874 | Tropical Forest Soil | MKVLAILTAAAVTLFSVSAFAQYVGKGKAPPPVVTKG |
| Ga0318516_100732111 | 3300031543 | Soil | MKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0318516_103403952 | 3300031543 | Soil | DFLFIMTKEGAMKTLVLAAAAALTLLSVAGCAQYVGKGKAPPPAAPVVTKG |
| Ga0318516_104554911 | 3300031543 | Soil | DSVGFSLCHDKRRGAMKVLAILTAAAVTLFSVSAFAQYVGKGKAPPPVVTKG |
| Ga0318541_103162522 | 3300031545 | Soil | MKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVV |
| Ga0318541_105706182 | 3300031545 | Soil | EGGSMRVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0318538_101224041 | 3300031546 | Soil | GSMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0318573_108091151 | 3300031564 | Soil | AVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0310915_100006419 | 3300031573 | Soil | MKTLVLAAAAALTLLSVAGCAQYVGKGKAPPPAAPVVTKG |
| Ga0310915_101543781 | 3300031573 | Soil | MKVLALLTAVALTLTVACCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0310915_109115941 | 3300031573 | Soil | KVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0318574_105754861 | 3300031680 | Soil | VMTKGGSMKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0318560_102928572 | 3300031682 | Soil | SMKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0306917_110468162 | 3300031719 | Soil | KLALVTAAILALSSVAASAQTYGVGKGKAPPPVVTKG |
| Ga0306918_100324795 | 3300031744 | Soil | MKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAP |
| Ga0306918_111888012 | 3300031744 | Soil | GVISTFVMTKEGALKTLALLTAAALTLLSVAGCAQYTGGPFGIGKGKAPPPAARRS |
| Ga0318502_104692261 | 3300031747 | Soil | TAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0318509_102509141 | 3300031768 | Soil | MKVLALLTAVALTLTVAGCAQYSGPFLGKGKTPPPAAPVV |
| Ga0318509_103647923 | 3300031768 | Soil | LTAVALTLAVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0318521_109127671 | 3300031770 | Soil | AVALTLTVAGCAQYSGPFLGKGKAPPPAAPVVTKG |
| Ga0318521_110515301 | 3300031770 | Soil | MKTLVLAAAAALTLLSVAGCAQYVGKGKAPPPAAPVVTK |
| Ga0318546_104077301 | 3300031771 | Soil | MKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPV |
| Ga0318550_100618111 | 3300031797 | Soil | ACRDKGGSMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0318550_102557552 | 3300031797 | Soil | KVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0318568_106890632 | 3300031819 | Soil | ALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0318567_102370174 | 3300031821 | Soil | MTKGGSMKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0310917_104543732 | 3300031833 | Soil | EGGSMKVLALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0318495_103191273 | 3300031860 | Soil | MPRGSTIMKAVAILTAAAVTLFSVSAFAQYVGKGKAPPPVVTKG |
| Ga0306919_109341751 | 3300031879 | Soil | LLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0318544_102638201 | 3300031880 | Soil | LALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0306925_105882703 | 3300031890 | Soil | VMTKGGSMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0306925_122297701 | 3300031890 | Soil | RVMTKGGSMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0306921_105746331 | 3300031912 | Soil | KGGSMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0310910_103586133 | 3300031946 | Soil | VLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0310910_115681512 | 3300031946 | Soil | VPSLVWLACHDEGGSMKVLALLTVVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0306926_122166562 | 3300031954 | Soil | MKVLALLTAVALTVAGCAQYGGPFGKGKAPPLLRQS |
| Ga0310911_101249791 | 3300032035 | Soil | SMKVLALLTAVALTLTVAGCAQYGGPFLGKGKAPPPAAPVVTKG |
| Ga0318545_103922542 | 3300032042 | Soil | LLTAVAVALTLTVAGCAQYSGPFLGKGKAPPPAAPVVTKG |
| Ga0318532_100631973 | 3300032051 | Soil | DRTLGTDFLFIMTKEGAMKTLVLAAAAALTLLSVAGCAQYVGKGKAPPPAAPVVTKG |
| Ga0318570_104627701 | 3300032054 | Soil | ALLTAVALTLTVAGCAQYGGPFFGKGKAPPPAAPVVTKG |
| Ga0318514_104868201 | 3300032066 | Soil | MKVLAILTAAAVTLFSVSAFAQYVGKGKAPPPVVTK |
| Ga0306924_106216583 | 3300032076 | Soil | MKVLALLTAVALTLTVAGCAQYSGPFLGKGKTPPPAAPVVTKG |
| Ga0306924_124388811 | 3300032076 | Soil | MKVLALLTVAALTLTVAGCAQYGGPFLGKGKAPPPAAPVV |
| Ga0306920_1005737421 | 3300032261 | Soil | MKVLALLTAVALTLTVACCAQYGGPFFGKGKAPPPAAP |
| ⦗Top⦘ |