| Basic Information | |
|---|---|
| Family ID | F105797 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTLKQEKK |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.00 % |
| % of genes near scaffold ends (potentially truncated) | 42.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.00 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 88.00% β-sheet: 0.00% Coil/Unstructured: 12.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF12323 | HTH_OrfB_IS605 | 72.00 |
| PF00496 | SBP_bac_5 | 3.00 |
| PF07282 | OrfB_Zn_ribbon | 2.00 |
| PF13649 | Methyltransf_25 | 2.00 |
| PF00391 | PEP-utilizers | 1.00 |
| PF00578 | AhpC-TSA | 1.00 |
| PF00480 | ROK | 1.00 |
| PF00326 | Peptidase_S9 | 1.00 |
| PF01385 | OrfB_IS605 | 1.00 |
| PF08281 | Sigma70_r4_2 | 1.00 |
| PF13808 | DDE_Tnp_1_assoc | 1.00 |
| PF13546 | DDE_5 | 1.00 |
| PF13676 | TIR_2 | 1.00 |
| PF12697 | Abhydrolase_6 | 1.00 |
| PF14520 | HHH_5 | 1.00 |
| PF00316 | FBPase | 1.00 |
| PF02683 | DsbD | 1.00 |
| PF01326 | PPDK_N | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 2.00 |
| COG0158 | Fructose-1,6-bisphosphatase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG0675 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.00 % |
| Unclassified | root | N/A | 5.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1027455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 983 | Open in IMG/M |
| 3300002909|JGI25388J43891_1077499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 512 | Open in IMG/M |
| 3300004153|Ga0063455_100911202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
| 3300005166|Ga0066674_10008741 | All Organisms → cellular organisms → Bacteria | 4121 | Open in IMG/M |
| 3300005174|Ga0066680_10651926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 653 | Open in IMG/M |
| 3300005181|Ga0066678_10210308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1245 | Open in IMG/M |
| 3300005187|Ga0066675_10910371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 664 | Open in IMG/M |
| 3300005445|Ga0070708_101397206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 653 | Open in IMG/M |
| 3300005446|Ga0066686_10852860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
| 3300005454|Ga0066687_10190653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1112 | Open in IMG/M |
| 3300005471|Ga0070698_100166655 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300005555|Ga0066692_10507588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 767 | Open in IMG/M |
| 3300005558|Ga0066698_10079102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2136 | Open in IMG/M |
| 3300005568|Ga0066703_10384929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 841 | Open in IMG/M |
| 3300005587|Ga0066654_10611458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 604 | Open in IMG/M |
| 3300005598|Ga0066706_10056594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2680 | Open in IMG/M |
| 3300005598|Ga0066706_10870353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 705 | Open in IMG/M |
| 3300006031|Ga0066651_10491600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
| 3300006034|Ga0066656_10494454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 798 | Open in IMG/M |
| 3300006046|Ga0066652_100039015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3485 | Open in IMG/M |
| 3300006172|Ga0075018_10603020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300006794|Ga0066658_10101872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1361 | Open in IMG/M |
| 3300006797|Ga0066659_10450392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1023 | Open in IMG/M |
| 3300006800|Ga0066660_10312549 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300007982|Ga0102924_1271431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 689 | Open in IMG/M |
| 3300009012|Ga0066710_100873107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1383 | Open in IMG/M |
| 3300009012|Ga0066710_101867850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 902 | Open in IMG/M |
| 3300009137|Ga0066709_100335007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2072 | Open in IMG/M |
| 3300009137|Ga0066709_102282668 | Not Available | 743 | Open in IMG/M |
| 3300009137|Ga0066709_102477280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 701 | Open in IMG/M |
| 3300010048|Ga0126373_10379900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1433 | Open in IMG/M |
| 3300010066|Ga0127427_104982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300010072|Ga0127428_106560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 683 | Open in IMG/M |
| 3300010091|Ga0127485_1055672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 717 | Open in IMG/M |
| 3300010093|Ga0127490_1038951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 737 | Open in IMG/M |
| 3300010093|Ga0127490_1075719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300010095|Ga0127475_1050529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 860 | Open in IMG/M |
| 3300010096|Ga0127473_1099894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 781 | Open in IMG/M |
| 3300010103|Ga0127500_1135741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300010108|Ga0127474_1127505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300010118|Ga0127465_1009422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1533 | Open in IMG/M |
| 3300010127|Ga0127489_1103332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 810 | Open in IMG/M |
| 3300010128|Ga0127486_1020037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
| 3300010134|Ga0127484_1164254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1333 | Open in IMG/M |
| 3300010141|Ga0127499_1212814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 841 | Open in IMG/M |
| 3300010322|Ga0134084_10425704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 523 | Open in IMG/M |
| 3300010333|Ga0134080_10046677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1694 | Open in IMG/M |
| 3300010335|Ga0134063_10047838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1861 | Open in IMG/M |
| 3300010358|Ga0126370_11164504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 715 | Open in IMG/M |
| 3300010359|Ga0126376_11744857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 659 | Open in IMG/M |
| 3300010366|Ga0126379_12658257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer → Ktedonobacter racemifer DSM 44963 | 598 | Open in IMG/M |
| 3300010379|Ga0136449_100762814 | Not Available | 1607 | Open in IMG/M |
| 3300010905|Ga0138112_1161299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1462 | Open in IMG/M |
| 3300011271|Ga0137393_10688732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 876 | Open in IMG/M |
| 3300011332|Ga0126317_10848216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 843 | Open in IMG/M |
| 3300012198|Ga0137364_10017603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4308 | Open in IMG/M |
| 3300012198|Ga0137364_10390817 | Not Available | 1040 | Open in IMG/M |
| 3300012199|Ga0137383_11132177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 565 | Open in IMG/M |
| 3300012199|Ga0137383_11351072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300012201|Ga0137365_10005170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 10472 | Open in IMG/M |
| 3300012206|Ga0137380_10220042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1717 | Open in IMG/M |
| 3300012206|Ga0137380_10762708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 837 | Open in IMG/M |
| 3300012206|Ga0137380_11224864 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012207|Ga0137381_10583268 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300012207|Ga0137381_11478861 | Not Available | 571 | Open in IMG/M |
| 3300012209|Ga0137379_10763358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 872 | Open in IMG/M |
| 3300012210|Ga0137378_11751331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300012211|Ga0137377_10076891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3134 | Open in IMG/M |
| 3300012349|Ga0137387_10413263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 979 | Open in IMG/M |
| 3300012351|Ga0137386_10823000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 667 | Open in IMG/M |
| 3300012356|Ga0137371_11195558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 568 | Open in IMG/M |
| 3300012357|Ga0137384_10427317 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300012357|Ga0137384_10798027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 764 | Open in IMG/M |
| 3300012359|Ga0137385_11455671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300012359|Ga0137385_11507019 | Not Available | 536 | Open in IMG/M |
| 3300012361|Ga0137360_10889122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 768 | Open in IMG/M |
| 3300012382|Ga0134038_1273200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1103 | Open in IMG/M |
| 3300012383|Ga0134033_1270702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1156 | Open in IMG/M |
| 3300012391|Ga0134035_1021538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1202 | Open in IMG/M |
| 3300012405|Ga0134041_1266044 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300012410|Ga0134060_1125262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1073 | Open in IMG/M |
| 3300012917|Ga0137395_11072646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 572 | Open in IMG/M |
| 3300014154|Ga0134075_10564469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300017654|Ga0134069_1149227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 780 | Open in IMG/M |
| 3300017821|Ga0187812_1008430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3571 | Open in IMG/M |
| 3300017934|Ga0187803_10056821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1543 | Open in IMG/M |
| 3300018431|Ga0066655_11354315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300018468|Ga0066662_10773365 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300018468|Ga0066662_11583933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 683 | Open in IMG/M |
| 3300021476|Ga0187846_10153051 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300021559|Ga0210409_11402121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 575 | Open in IMG/M |
| 3300021560|Ga0126371_12965064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
| 3300025928|Ga0207700_10172794 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300026300|Ga0209027_1003363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6040 | Open in IMG/M |
| 3300026301|Ga0209238_1168395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 649 | Open in IMG/M |
| 3300026322|Ga0209687_1174591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 676 | Open in IMG/M |
| 3300026326|Ga0209801_1214450 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300026538|Ga0209056_10004101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 15354 | Open in IMG/M |
| 3300026551|Ga0209648_10124062 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300026552|Ga0209577_10246623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1349 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 25.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010066 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010072 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010095 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10274552 | 3300002557 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTLKQEKK* |
| JGI25388J43891_10774991 | 3300002909 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0063455_1009112021 | 3300004153 | Soil | TKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTLKQEKK* |
| Ga0066674_100087412 | 3300005166 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTIRQEKK* |
| Ga0066680_106519262 | 3300005174 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDTELERTIKQEKK |
| Ga0066678_102103083 | 3300005181 | Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIEAELTQTLKQEKQKV* |
| Ga0066675_109103712 | 3300005187 | Soil | IVTTKIKRESLRKLKAIAALRQETMLSVLERLIDVELERTIKQEKKQP* |
| Ga0070708_1013972062 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DIVTTKIKRESLRKLKAIAALKQETMLAVLERLIDAELERTIKQEKH* |
| Ga0066686_108528602 | 3300005446 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTIKQEKK* |
| Ga0066687_101906532 | 3300005454 | Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLLDAELERTIKQEKK* |
| Ga0070698_1001666551 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIDAELERTIKQEKH* |
| Ga0066692_105075882 | 3300005555 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLLDAELERTIKQEKK* |
| Ga0066698_100791023 | 3300005558 | Soil | IKRESLRKLKAIAALKQETMLSVLERLLDAELERTLKQEKKEL* |
| Ga0066703_103849292 | 3300005568 | Soil | ESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0066654_106114581 | 3300005587 | Soil | LKAIAALKQETMLSVLERLIEAELERTLKQEKKEL* |
| Ga0066706_100565941 | 3300005598 | Soil | KRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0066706_108703532 | 3300005598 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTIKQEKKSS* |
| Ga0066651_104916002 | 3300006031 | Soil | IKRESLRKLKAIAALNQETMLSVLERLIEAELERTLKQEKK* |
| Ga0066656_104944542 | 3300006034 | Soil | KIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKKEL* |
| Ga0066652_1000390151 | 3300006046 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKK* |
| Ga0075018_106030202 | 3300006172 | Watersheds | RKLKAIAALKQETMLSVLERLIKAELERTLKQEKK* |
| Ga0066658_101018723 | 3300006794 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLLDAELERTLKQEKK* |
| Ga0066659_104503922 | 3300006797 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDTELERTIKQEKK* |
| Ga0066660_103125492 | 3300006800 | Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERVLKQEKQQA* |
| Ga0102924_12714312 | 3300007982 | Iron-Sulfur Acid Spring | MNDETVTTKIKRESLRKLKAIAALQQETMLAVLERLIDTELTRVLKQEKPEP* |
| Ga0066710_1008731072 | 3300009012 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKK |
| Ga0066710_1018678502 | 3300009012 | Grasslands Soil | MKQDIVTTKIKRESLRKLKAIAALRQETMLSVLERLIDVELERTIKQEKKQP |
| Ga0066709_1003350071 | 3300009137 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTIKQEK |
| Ga0066709_1022826681 | 3300009137 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERT |
| Ga0066709_1024772801 | 3300009137 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKKEL* |
| Ga0126373_103799002 | 3300010048 | Tropical Forest Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLARLIDAELERTITQEKHSP* |
| Ga0127427_1049822 | 3300010066 | Grasslands Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKQSS* |
| Ga0127428_1065601 | 3300010072 | Grasslands Soil | IKRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0127485_10556722 | 3300010091 | Grasslands Soil | ESLRKLKAIAALKQETMLSVLERLIDAELERTIRQEKK* |
| Ga0127490_10389511 | 3300010093 | Grasslands Soil | KIKRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0127490_10757192 | 3300010093 | Grasslands Soil | VVTTKIKRESLRKLKAIAALNQETMLSVLERLIEAELERTLKQEKK* |
| Ga0127475_10505292 | 3300010095 | Grasslands Soil | VVTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0127473_10998942 | 3300010096 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTLKQEKKEL* |
| Ga0127500_11357412 | 3300010103 | Grasslands Soil | VTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTIRQEKK* |
| Ga0127474_11275051 | 3300010108 | Grasslands Soil | KIKRESLRKLKAIAALNQETMLSVLERLIEAELERTLKQEKK* |
| Ga0127465_10094223 | 3300010118 | Grasslands Soil | TTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0127489_11033321 | 3300010127 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTIRQEKK* |
| Ga0127486_10200371 | 3300010128 | Grasslands Soil | KQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELEQTLKQEKK* |
| Ga0127484_11642542 | 3300010134 | Grasslands Soil | PMKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTLKQEKK* |
| Ga0127499_12128142 | 3300010141 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLEQLIDAELERTIRQEKK* |
| Ga0134084_104257041 | 3300010322 | Grasslands Soil | MKQDVVTTKIKPESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0134080_100466772 | 3300010333 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLIDTELERTIKQERK* |
| Ga0134063_100478381 | 3300010335 | Grasslands Soil | RESLRKLKAIAALQQETMLTVLERLIDAELERTIKQEKKMP* |
| Ga0126370_111645042 | 3300010358 | Tropical Forest Soil | VKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIDAELERTITQEKHSP* |
| Ga0126376_117448571 | 3300010359 | Tropical Forest Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIDAELERTITQEKHSP* |
| Ga0126379_126582572 | 3300010366 | Tropical Forest Soil | LKQDVVTTKIKRESLRKLKAIAALRQETMPSVLERLLDAELERANKQEKKEL* |
| Ga0136449_1007628142 | 3300010379 | Peatlands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDKELE |
| Ga0138112_11612992 | 3300010905 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTLKQEKK* |
| Ga0137393_106887321 | 3300011271 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQETLLSVLERLIDAELERTIKQEKK* |
| Ga0126317_108482161 | 3300011332 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTLKQEKKSP* |
| Ga0137364_100176034 | 3300012198 | Vadose Zone Soil | VTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK* |
| Ga0137364_103908172 | 3300012198 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALNQETMLSVLERLIEAELERTLKQEKK* |
| Ga0137383_111321772 | 3300012199 | Vadose Zone Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIEAELTQTLKQEKQKG* |
| Ga0137383_113510721 | 3300012199 | Vadose Zone Soil | KVEQNTPMKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTIKQEKKSS* |
| Ga0137365_100051702 | 3300012201 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQETLLSVLERLIDAELERTLKQEKK* |
| Ga0137380_102200421 | 3300012206 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKKSS* |
| Ga0137380_107627081 | 3300012206 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLER |
| Ga0137380_112248641 | 3300012206 | Vadose Zone Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIEA |
| Ga0137381_105832681 | 3300012207 | Vadose Zone Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLSVLERLLDAELERTIKQ |
| Ga0137381_114788611 | 3300012207 | Vadose Zone Soil | MKPDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEA |
| Ga0137379_107633581 | 3300012209 | Vadose Zone Soil | MKPDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKKSS* |
| Ga0137378_117513311 | 3300012210 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQATMLSILEWLLDAELERTLKQEKKEP* |
| Ga0137377_100768911 | 3300012211 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDTELE |
| Ga0137387_104132632 | 3300012349 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLAVLERLIEAELTQTLKQEKQKV* |
| Ga0137386_108230002 | 3300012351 | Vadose Zone Soil | KQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIEAELTQTLKQEKQKV* |
| Ga0137371_111955582 | 3300012356 | Vadose Zone Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIEAELTHTLKQEKQKV* |
| Ga0137384_104273172 | 3300012357 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDTELERTLKQEKK* |
| Ga0137384_107980272 | 3300012357 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQATMLSILEWLLDAELQRTLKQEKKEP* |
| Ga0137385_114556711 | 3300012359 | Vadose Zone Soil | RKLKAIAALKQETMLSVLERLLDAELERTIKQEKK* |
| Ga0137385_115070191 | 3300012359 | Vadose Zone Soil | MKPDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKKLS* |
| Ga0137360_108891222 | 3300012361 | Vadose Zone Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLLNAELEQALKQEKPKV* |
| Ga0134038_12732001 | 3300012382 | Grasslands Soil | KIKRESLRKLKAIAALQQETMLSVLERLIDAELERTLKQEKK* |
| Ga0134033_12707021 | 3300012383 | Grasslands Soil | IKRESLRKLKAIAALQQETMLSVLERLIDAELERTLKQEKK* |
| Ga0134035_10215382 | 3300012391 | Grasslands Soil | VTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTLKQEKK* |
| Ga0134041_12660442 | 3300012405 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKKEL* |
| Ga0134060_11252621 | 3300012410 | Grasslands Soil | NTPMKQDVVTTKIKRESLRKLKAIAALNQETMLSVLERFIEAELERTLKQEKK* |
| Ga0137395_110726461 | 3300012917 | Vadose Zone Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIDAELTQTLKQEKQKV* |
| Ga0134075_105644691 | 3300014154 | Grasslands Soil | DVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTIRQEKK* |
| Ga0134069_11492272 | 3300017654 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTIKQEKK |
| Ga0187812_10084302 | 3300017821 | Freshwater Sediment | MKQDVVTTKIKRESLRKLKAIAALKQETMLTVLERLIDTELERTLKQEKQ |
| Ga0187803_100568211 | 3300017934 | Freshwater Sediment | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERTIRQEKK |
| Ga0066655_113543151 | 3300018431 | Grasslands Soil | KIKRESLRKLKAIAALKQETMLSVLERLIEAELERTLKQEKKEL |
| Ga0066662_107733651 | 3300018468 | Grasslands Soil | SLRKLKAIAALKQETMLSVLERLIDAELERVLKQEKQQA |
| Ga0066662_115839332 | 3300018468 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLDRLIEAELERTIEQEKK |
| Ga0187846_101530512 | 3300021476 | Biofilm | VKQEIVTTKIKRESLRKLKAIAALKQETMLAVLARLIDAELERTITQEKHSP |
| Ga0210409_114021212 | 3300021559 | Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLTVLERLIDAELTQTLKQEKQKV |
| Ga0126371_129650641 | 3300021560 | Tropical Forest Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLARLIDAELERTITQEKHSP |
| Ga0207700_101727941 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQDIVTTKIKRESLRKLKAIAALRQETMLSVLERLIDV |
| Ga0209027_10033633 | 3300026300 | Grasslands Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLIDAELERTIKQEKK |
| Ga0209238_11683952 | 3300026301 | Grasslands Soil | RESLRKLKAIAALQQGTMLSVLERLIDVELERTLKQEKK |
| Ga0209687_11745912 | 3300026322 | Soil | MKQDVVTTKIKRESLRKLKAIAALQQETMLSVLERLLDAELERTIKQEKK |
| Ga0209801_12144502 | 3300026326 | Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLAVLERLIEAELTQTLKQEKQKV |
| Ga0209056_1000410110 | 3300026538 | Soil | MKQDVVTTKIKRESLRKLKAIAALKQETMLSVLERLIEAELERTIKQEKKSS |
| Ga0209648_101240622 | 3300026551 | Grasslands Soil | MKQDIVTTKIKRESLRKLKAIAALKQDTMLAVLERLIDAELTQTLKQEKQKV |
| Ga0209577_102466232 | 3300026552 | Soil | MKQDIVTTKIKRESLRKLKAIAALKQETMLSVLERLIDAELERVLKQEKQQA |
| ⦗Top⦘ |