| Basic Information | |
|---|---|
| Family ID | F105779 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.58% Coil/Unstructured: 85.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01638 | HxlR | 9.00 |
| PF13847 | Methyltransf_31 | 6.00 |
| PF00583 | Acetyltransf_1 | 3.00 |
| PF08031 | BBE | 3.00 |
| PF13302 | Acetyltransf_3 | 2.00 |
| PF07929 | PRiA4_ORF3 | 2.00 |
| PF13936 | HTH_38 | 2.00 |
| PF13649 | Methyltransf_25 | 2.00 |
| PF09948 | DUF2182 | 2.00 |
| PF01527 | HTH_Tnp_1 | 1.00 |
| PF00171 | Aldedh | 1.00 |
| PF03682 | UPF0158 | 1.00 |
| PF12697 | Abhydrolase_6 | 1.00 |
| PF08241 | Methyltransf_11 | 1.00 |
| PF11716 | MDMPI_N | 1.00 |
| PF03070 | TENA_THI-4 | 1.00 |
| PF01575 | MaoC_dehydratas | 1.00 |
| PF00400 | WD40 | 1.00 |
| PF00581 | Rhodanese | 1.00 |
| PF03583 | LIP | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 9.00 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 3.00 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.00 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.00 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.00 % |
| Unclassified | root | N/A | 29.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig92943 | Not Available | 608 | Open in IMG/M |
| 3300002070|JGI24750J21931_1035317 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 745 | Open in IMG/M |
| 3300004157|Ga0062590_100166853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1537 | Open in IMG/M |
| 3300004463|Ga0063356_100162568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 2568 | Open in IMG/M |
| 3300005328|Ga0070676_10898514 | Not Available | 659 | Open in IMG/M |
| 3300005334|Ga0068869_100086721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2347 | Open in IMG/M |
| 3300005335|Ga0070666_10196705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 1418 | Open in IMG/M |
| 3300005340|Ga0070689_100291820 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1355 | Open in IMG/M |
| 3300005347|Ga0070668_100684260 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300005356|Ga0070674_100081356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2315 | Open in IMG/M |
| 3300005365|Ga0070688_100541725 | Not Available | 883 | Open in IMG/M |
| 3300005365|Ga0070688_101187525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 613 | Open in IMG/M |
| 3300005367|Ga0070667_100093363 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
| 3300005367|Ga0070667_100799423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 876 | Open in IMG/M |
| 3300005437|Ga0070710_10190778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 1289 | Open in IMG/M |
| 3300005437|Ga0070710_10341577 | Not Available | 989 | Open in IMG/M |
| 3300005439|Ga0070711_100195459 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1557 | Open in IMG/M |
| 3300005441|Ga0070700_100094204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1960 | Open in IMG/M |
| 3300005441|Ga0070700_100655187 | Not Available | 829 | Open in IMG/M |
| 3300005455|Ga0070663_100795668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 810 | Open in IMG/M |
| 3300005457|Ga0070662_100225987 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300005468|Ga0070707_101389585 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 669 | Open in IMG/M |
| 3300005543|Ga0070672_100463044 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1093 | Open in IMG/M |
| 3300005545|Ga0070695_100863978 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 729 | Open in IMG/M |
| 3300005548|Ga0070665_101660078 | Not Available | 646 | Open in IMG/M |
| 3300005549|Ga0070704_101516311 | Not Available | 617 | Open in IMG/M |
| 3300005563|Ga0068855_101604617 | Not Available | 665 | Open in IMG/M |
| 3300005578|Ga0068854_100132925 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
| 3300005617|Ga0068859_101562354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 728 | Open in IMG/M |
| 3300006173|Ga0070716_100106036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1732 | Open in IMG/M |
| 3300006175|Ga0070712_100314039 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1272 | Open in IMG/M |
| 3300006881|Ga0068865_100049926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2887 | Open in IMG/M |
| 3300006881|Ga0068865_100367717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1169 | Open in IMG/M |
| 3300009092|Ga0105250_10055241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 1593 | Open in IMG/M |
| 3300009098|Ga0105245_12032833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 628 | Open in IMG/M |
| 3300009101|Ga0105247_11071238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 634 | Open in IMG/M |
| 3300009148|Ga0105243_10282834 | Not Available | 1495 | Open in IMG/M |
| 3300009148|Ga0105243_12100079 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300009174|Ga0105241_10212984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1620 | Open in IMG/M |
| 3300009176|Ga0105242_12386007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. | 576 | Open in IMG/M |
| 3300009551|Ga0105238_10708679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 1019 | Open in IMG/M |
| 3300009553|Ga0105249_10100543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 2719 | Open in IMG/M |
| 3300009553|Ga0105249_11911649 | Not Available | 666 | Open in IMG/M |
| 3300010371|Ga0134125_11831807 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300010373|Ga0134128_11662531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 703 | Open in IMG/M |
| 3300010396|Ga0134126_11447445 | Not Available | 758 | Open in IMG/M |
| 3300010397|Ga0134124_11474621 | Not Available | 708 | Open in IMG/M |
| 3300010400|Ga0134122_11528216 | Not Available | 688 | Open in IMG/M |
| 3300010400|Ga0134122_11610596 | Not Available | 673 | Open in IMG/M |
| 3300010403|Ga0134123_10443161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1205 | Open in IMG/M |
| 3300012960|Ga0164301_10882032 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012960|Ga0164301_11464710 | Not Available | 561 | Open in IMG/M |
| 3300012984|Ga0164309_11892344 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012985|Ga0164308_10681836 | Not Available | 884 | Open in IMG/M |
| 3300012985|Ga0164308_11975840 | Not Available | 544 | Open in IMG/M |
| 3300012986|Ga0164304_11574398 | Not Available | 546 | Open in IMG/M |
| 3300012988|Ga0164306_10351858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. ITM-2016-00317 | 1092 | Open in IMG/M |
| 3300012989|Ga0164305_11722588 | Not Available | 563 | Open in IMG/M |
| 3300013096|Ga0157307_1134566 | Not Available | 560 | Open in IMG/M |
| 3300013100|Ga0157373_10329085 | Not Available | 1088 | Open in IMG/M |
| 3300013297|Ga0157378_10698758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 1033 | Open in IMG/M |
| 3300013306|Ga0163162_12289122 | Not Available | 621 | Open in IMG/M |
| 3300014745|Ga0157377_10230117 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300014745|Ga0157377_10836261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium madagascariense | 682 | Open in IMG/M |
| 3300015374|Ga0132255_104611343 | Not Available | 584 | Open in IMG/M |
| 3300017966|Ga0187776_10213068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1220 | Open in IMG/M |
| 3300017966|Ga0187776_10454698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 867 | Open in IMG/M |
| 3300021361|Ga0213872_10265404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300021439|Ga0213879_10064171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 990 | Open in IMG/M |
| 3300025711|Ga0207696_1131967 | Not Available | 671 | Open in IMG/M |
| 3300025898|Ga0207692_10573362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 723 | Open in IMG/M |
| 3300025899|Ga0207642_10606973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 682 | Open in IMG/M |
| 3300025903|Ga0207680_10365210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 1016 | Open in IMG/M |
| 3300025923|Ga0207681_10535139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 963 | Open in IMG/M |
| 3300025926|Ga0207659_11856611 | Not Available | 511 | Open in IMG/M |
| 3300025927|Ga0207687_10196893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1572 | Open in IMG/M |
| 3300025934|Ga0207686_10308751 | Not Available | 1177 | Open in IMG/M |
| 3300025938|Ga0207704_10493781 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300025939|Ga0207665_10195170 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300025986|Ga0207658_10197319 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300026067|Ga0207678_10248313 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1524 | Open in IMG/M |
| 3300026089|Ga0207648_10127474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 2239 | Open in IMG/M |
| 3300026089|Ga0207648_10366294 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1301 | Open in IMG/M |
| 3300026089|Ga0207648_10489410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1124 | Open in IMG/M |
| 3300026089|Ga0207648_10579798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1032 | Open in IMG/M |
| 3300026118|Ga0207675_100683107 | Not Available | 1034 | Open in IMG/M |
| 3300026118|Ga0207675_100761714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae | 980 | Open in IMG/M |
| 3300026142|Ga0207698_12643788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 511 | Open in IMG/M |
| 3300027603|Ga0209331_1008869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2653 | Open in IMG/M |
| 3300027824|Ga0209040_10175939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1132 | Open in IMG/M |
| 3300028380|Ga0268265_10198006 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300028380|Ga0268265_12449756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 528 | Open in IMG/M |
| 3300028381|Ga0268264_12531670 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300028381|Ga0268264_12701783 | Not Available | 500 | Open in IMG/M |
| 3300031962|Ga0307479_10469288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1242 | Open in IMG/M |
| 3300032174|Ga0307470_11180446 | Not Available | 620 | Open in IMG/M |
| 3300032205|Ga0307472_101890776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 595 | Open in IMG/M |
| 3300032782|Ga0335082_10615276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 948 | Open in IMG/M |
| 3300032892|Ga0335081_10497694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1534 | Open in IMG/M |
| 3300032892|Ga0335081_10862073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1073 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 9.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 8.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0943.00005940 | 2166559005 | Simulated | MWVPRSATADWPADDRIGISVLDCLHCDGTGTVCLDPGRGNRPTRSGR |
| JGI24750J21931_10353171 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | ADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0062590_1001668531 | 3300004157 | Soil | PRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0063356_1001625685 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TADWPADDRIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR* |
| Ga0070676_108985142 | 3300005328 | Miscanthus Rhizosphere | MWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRPGVP* |
| Ga0068869_1000867211 | 3300005334 | Miscanthus Rhizosphere | EASMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG* |
| Ga0070666_101967053 | 3300005335 | Switchgrass Rhizosphere | WVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0070689_1002918202 | 3300005340 | Switchgrass Rhizosphere | AYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0070668_1006842603 | 3300005347 | Switchgrass Rhizosphere | MWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRG |
| Ga0070674_1000813563 | 3300005356 | Miscanthus Rhizosphere | QLAYDLEATMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPARGNRPTRSGR* |
| Ga0070688_1005417253 | 3300005365 | Switchgrass Rhizosphere | MWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR* |
| Ga0070688_1011875251 | 3300005365 | Switchgrass Rhizosphere | MWVPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGPGNRPTRSGR* |
| Ga0070667_1000933635 | 3300005367 | Switchgrass Rhizosphere | GDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR |
| Ga0070667_1007994233 | 3300005367 | Switchgrass Rhizosphere | LAYDLEATMWVPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0070710_101907781 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0070710_103415772 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0070711_1001954591 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ECAGDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0070700_1000942043 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | CAGDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0070700_1006551871 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | AYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR* |
| Ga0070663_1007956682 | 3300005455 | Corn Rhizosphere | ADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0070662_1002259872 | 3300005457 | Corn Rhizosphere | MWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0070707_1013895851 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TADWPADDCIGISVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0070672_1004630442 | 3300005543 | Miscanthus Rhizosphere | TADWPADDRIGISVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0070695_1008639782 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0070665_1016600781 | 3300005548 | Switchgrass Rhizosphere | MWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTK |
| Ga0070704_1015163111 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ATADWPADDGIGISVLDCPQCDGTGTVRLDPRRGNRPTRSGR* |
| Ga0068855_1016046171 | 3300005563 | Corn Rhizosphere | LEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR* |
| Ga0068854_1001329251 | 3300005578 | Corn Rhizosphere | ATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0068859_1015623541 | 3300005617 | Switchgrass Rhizosphere | DWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0070716_1001060361 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPARGNRPTRSGR* |
| Ga0070712_1003140392 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR* |
| Ga0068865_1000499261 | 3300006881 | Miscanthus Rhizosphere | DWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG* |
| Ga0068865_1003677173 | 3300006881 | Miscanthus Rhizosphere | ADDCIGISVLDCLQCDGTGTVRLDPGRGSRPTRSGR* |
| Ga0105250_100552411 | 3300009092 | Switchgrass Rhizosphere | TADWPADDCIGISELDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0105245_120328331 | 3300009098 | Miscanthus Rhizosphere | DDRIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR* |
| Ga0105247_110712383 | 3300009101 | Switchgrass Rhizosphere | RSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR* |
| Ga0105243_102828341 | 3300009148 | Miscanthus Rhizosphere | ECAGDGQLAYDLEAAMWVPRSATADWAADDCIGISVLDCLQCDGTGTVRLDSGRGDRPTRSGR* |
| Ga0105243_121000791 | 3300009148 | Miscanthus Rhizosphere | TADWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG* |
| Ga0105241_102129841 | 3300009174 | Corn Rhizosphere | ECAGDGQLAYDLEASVWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR* |
| Ga0105242_123860071 | 3300009176 | Miscanthus Rhizosphere | MWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0105238_107086792 | 3300009551 | Corn Rhizosphere | CAGDGQLAYDLEASMWVPRSATADWPAADCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0105249_101005434 | 3300009553 | Switchgrass Rhizosphere | WVPRGATADWPADDCIGISVIDCLQCDGTGTVRLDPGHGNRPRRSGQ* |
| Ga0105249_119116491 | 3300009553 | Switchgrass Rhizosphere | CAGDGQLAYDLEAAMWVPRSATADWPADDGIGISVLDCPQCDGTGTVRLDPRRGNRPTRSGR* |
| Ga0134125_118318072 | 3300010371 | Terrestrial Soil | GDGQLAYDQEASMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG* |
| Ga0134128_116625311 | 3300010373 | Terrestrial Soil | YDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0134126_114474452 | 3300010396 | Terrestrial Soil | GDGQLAYDQEASMWVPRSATADWPADDCIGICVIDCLQCDGTGTVRLDPGHGNRPRRSGQ |
| Ga0134124_114746212 | 3300010397 | Terrestrial Soil | YDLEAAMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR* |
| Ga0134122_115282162 | 3300010400 | Terrestrial Soil | MWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR* |
| Ga0134122_116105961 | 3300010400 | Terrestrial Soil | MWVPRSATADWPADDGIGISVLDCPQCDGTGTVRLDPRRGNRPTRSGR* |
| Ga0134123_104431611 | 3300010403 | Terrestrial Soil | PADDCIGISVLDCLQCDGTGTVRLDPGPGNRPTRSGR* |
| Ga0164301_108820321 | 3300012960 | Soil | YDLEATMWVPRSATADWPADDRIGASVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0164301_114647102 | 3300012960 | Soil | GQLAYDLEAAMWVPRSATADWAADDCIGISVLDCLQCNGTGTVWLDPGHGSRPTRSGR* |
| Ga0164309_118923441 | 3300012984 | Soil | MWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG* |
| Ga0164308_106818363 | 3300012985 | Soil | QLAYDLEATMWVPRSATADWPAYDRIGISVLDCLQCDGTGTVRLDPARGNRRTRSGR* |
| Ga0164308_119758401 | 3300012985 | Soil | DCIGISVLDCLQCDGTGTVRLDPGRGNRPTRFGR* |
| Ga0164304_115743981 | 3300012986 | Soil | GDGQLAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVQLDPGRGNRPTRSGR |
| Ga0164306_103518582 | 3300012988 | Soil | AGDGQLAYDLEATMWVPRSATADWPADDCIGISVLDCRQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0164305_117225882 | 3300012989 | Soil | GDGQLAYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0157307_11345661 | 3300013096 | Soil | ECAGDGQLAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGMVRLDPGRGNRPTRSGR* |
| Ga0157373_103290853 | 3300013100 | Corn Rhizosphere | YDLEATMWVPRSAAADWPADDCIGISVLDCLQCDGTGTVRLDSGRGNRPRRSGR* |
| Ga0157378_106987581 | 3300013297 | Miscanthus Rhizosphere | RGLAPDDCIGISVLYCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0163162_122891222 | 3300013306 | Switchgrass Rhizosphere | PADDGIGISVLDCPQCDGTGTVRLDPRRGNRPTRSGR* |
| Ga0157377_102301171 | 3300014745 | Miscanthus Rhizosphere | ADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG* |
| Ga0157377_108362612 | 3300014745 | Miscanthus Rhizosphere | GQLAYDLEAAMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0132255_1046113431 | 3300015374 | Arabidopsis Rhizosphere | MWVPRSATADWSADDRIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR* |
| Ga0187776_102130683 | 3300017966 | Tropical Peatland | VCDECAGDGQLAYDLEATMWVPRSATADWPANDCIGISVLDCLQCDGTGTVRLDP |
| Ga0187776_104546981 | 3300017966 | Tropical Peatland | DDCIGISVLDCLQCDGTGTVRCDPGRANRPTRSGR |
| Ga0213872_102654042 | 3300021361 | Rhizosphere | DGQLAYDPEAAMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRANRPTRSGR |
| Ga0213879_100641711 | 3300021439 | Bulk Soil | YDLEAAMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDAGRANRPTRSGR |
| Ga0207696_11319672 | 3300025711 | Switchgrass Rhizosphere | MWVPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGRGNPPTRSGR |
| Ga0207692_105733623 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ASMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207642_106069733 | 3300025899 | Miscanthus Rhizosphere | DGQLAYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207680_103652101 | 3300025903 | Switchgrass Rhizosphere | WVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207681_105351393 | 3300025923 | Switchgrass Rhizosphere | MWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207659_118566112 | 3300025926 | Miscanthus Rhizosphere | MWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207687_101968933 | 3300025927 | Miscanthus Rhizosphere | WPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207686_103087511 | 3300025934 | Miscanthus Rhizosphere | MWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR |
| Ga0207704_104937811 | 3300025938 | Miscanthus Rhizosphere | AYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR |
| Ga0207665_101951701 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GQLAYDLEASVWIPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR |
| Ga0207658_101973191 | 3300025986 | Switchgrass Rhizosphere | DGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR |
| Ga0207678_102483131 | 3300026067 | Corn Rhizosphere | TMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR |
| Ga0207648_101274744 | 3300026089 | Miscanthus Rhizosphere | ECAGDGQLAYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207648_103662941 | 3300026089 | Miscanthus Rhizosphere | ECAGDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR |
| Ga0207648_104894102 | 3300026089 | Miscanthus Rhizosphere | LEATMWVPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGPGNRPTRSAGNSADLGVP |
| Ga0207648_105797981 | 3300026089 | Miscanthus Rhizosphere | WRSPVIGISVRDYLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207675_1006831072 | 3300026118 | Switchgrass Rhizosphere | ADWPADDCIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR |
| Ga0207675_1007617141 | 3300026118 | Switchgrass Rhizosphere | CAGDGQLAYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0207698_126437881 | 3300026142 | Corn Rhizosphere | AYDLEATMWIPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0209331_10088691 | 3300027603 | Forest Soil | GGRPAEDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0209040_101759391 | 3300027824 | Bog Forest Soil | WVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRANRPTRPGR |
| Ga0268265_101980061 | 3300028380 | Switchgrass Rhizosphere | YDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR |
| Ga0268265_124497561 | 3300028380 | Switchgrass Rhizosphere | SATADWPADDRIGISVLDCLQCDGTGMVRLDPGRGNRATRSGR |
| Ga0268264_125316701 | 3300028381 | Switchgrass Rhizosphere | DWPVDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0268264_127017831 | 3300028381 | Switchgrass Rhizosphere | GQLAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR |
| Ga0307479_104692882 | 3300031962 | Hardwood Forest Soil | LEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRANRPTRSGR |
| Ga0307470_111804461 | 3300032174 | Hardwood Forest Soil | PADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR |
| Ga0307472_1018907762 | 3300032205 | Hardwood Forest Soil | ATADWPADDRIGISVFDCLQCDGTGTVRLDPGRGNRPTRSGR |
| Ga0335082_106152761 | 3300032782 | Soil | MWVPRSATADWPADERIGISVLDCLQCDGTGTVRLDPGRGNRATRSGR |
| Ga0335081_104976942 | 3300032892 | Soil | AGDGQLAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRANRPTRSG |
| Ga0335081_108620731 | 3300032892 | Soil | DGQLAYDLEAAMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPERANRPTRSGR |
| ⦗Top⦘ |