NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105779

Metagenome Family F105779

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105779
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 50 residues
Representative Sequence MWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Number of Associated Samples 81
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.00 %
% of genes near scaffold ends (potentially truncated) 91.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(12.000 % of family members)
Environment Ontology (ENVO) Unclassified
(55.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(70.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 14.58%    Coil/Unstructured: 85.42%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF01638HxlR 9.00
PF13847Methyltransf_31 6.00
PF00583Acetyltransf_1 3.00
PF08031BBE 3.00
PF13302Acetyltransf_3 2.00
PF07929PRiA4_ORF3 2.00
PF13936HTH_38 2.00
PF13649Methyltransf_25 2.00
PF09948DUF2182 2.00
PF01527HTH_Tnp_1 1.00
PF00171Aldedh 1.00
PF03682UPF0158 1.00
PF12697Abhydrolase_6 1.00
PF08241Methyltransf_11 1.00
PF11716MDMPI_N 1.00
PF03070TENA_THI-4 1.00
PF01575MaoC_dehydratas 1.00
PF00400WD40 1.00
PF00581Rhodanese 1.00
PF03583LIP 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 9.00
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 3.00
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.00
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.00
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.00 %
UnclassifiedrootN/A29.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig92943Not Available608Open in IMG/M
3300002070|JGI24750J21931_1035317All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium745Open in IMG/M
3300004157|Ga0062590_100166853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1537Open in IMG/M
3300004463|Ga0063356_100162568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae2568Open in IMG/M
3300005328|Ga0070676_10898514Not Available659Open in IMG/M
3300005334|Ga0068869_100086721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2347Open in IMG/M
3300005335|Ga0070666_10196705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae1418Open in IMG/M
3300005340|Ga0070689_100291820All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1355Open in IMG/M
3300005347|Ga0070668_100684260All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005356|Ga0070674_100081356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2315Open in IMG/M
3300005365|Ga0070688_100541725Not Available883Open in IMG/M
3300005365|Ga0070688_101187525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae613Open in IMG/M
3300005367|Ga0070667_100093363All Organisms → cellular organisms → Bacteria2591Open in IMG/M
3300005367|Ga0070667_100799423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae876Open in IMG/M
3300005437|Ga0070710_10190778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae1289Open in IMG/M
3300005437|Ga0070710_10341577Not Available989Open in IMG/M
3300005439|Ga0070711_100195459All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1557Open in IMG/M
3300005441|Ga0070700_100094204All Organisms → cellular organisms → Bacteria → Proteobacteria1960Open in IMG/M
3300005441|Ga0070700_100655187Not Available829Open in IMG/M
3300005455|Ga0070663_100795668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae810Open in IMG/M
3300005457|Ga0070662_100225987All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300005468|Ga0070707_101389585All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium669Open in IMG/M
3300005543|Ga0070672_100463044All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1093Open in IMG/M
3300005545|Ga0070695_100863978All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium729Open in IMG/M
3300005548|Ga0070665_101660078Not Available646Open in IMG/M
3300005549|Ga0070704_101516311Not Available617Open in IMG/M
3300005563|Ga0068855_101604617Not Available665Open in IMG/M
3300005578|Ga0068854_100132925All Organisms → cellular organisms → Bacteria1902Open in IMG/M
3300005617|Ga0068859_101562354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae728Open in IMG/M
3300006173|Ga0070716_100106036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1732Open in IMG/M
3300006175|Ga0070712_100314039All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1272Open in IMG/M
3300006881|Ga0068865_100049926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2887Open in IMG/M
3300006881|Ga0068865_100367717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1169Open in IMG/M
3300009092|Ga0105250_10055241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae1593Open in IMG/M
3300009098|Ga0105245_12032833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae628Open in IMG/M
3300009101|Ga0105247_11071238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales634Open in IMG/M
3300009148|Ga0105243_10282834Not Available1495Open in IMG/M
3300009148|Ga0105243_12100079All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300009174|Ga0105241_10212984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1620Open in IMG/M
3300009176|Ga0105242_12386007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp.576Open in IMG/M
3300009551|Ga0105238_10708679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae1019Open in IMG/M
3300009553|Ga0105249_10100543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae2719Open in IMG/M
3300009553|Ga0105249_11911649Not Available666Open in IMG/M
3300010371|Ga0134125_11831807All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300010373|Ga0134128_11662531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae703Open in IMG/M
3300010396|Ga0134126_11447445Not Available758Open in IMG/M
3300010397|Ga0134124_11474621Not Available708Open in IMG/M
3300010400|Ga0134122_11528216Not Available688Open in IMG/M
3300010400|Ga0134122_11610596Not Available673Open in IMG/M
3300010403|Ga0134123_10443161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1205Open in IMG/M
3300012960|Ga0164301_10882032All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300012960|Ga0164301_11464710Not Available561Open in IMG/M
3300012984|Ga0164309_11892344All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012985|Ga0164308_10681836Not Available884Open in IMG/M
3300012985|Ga0164308_11975840Not Available544Open in IMG/M
3300012986|Ga0164304_11574398Not Available546Open in IMG/M
3300012988|Ga0164306_10351858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. ITM-2016-003171092Open in IMG/M
3300012989|Ga0164305_11722588Not Available563Open in IMG/M
3300013096|Ga0157307_1134566Not Available560Open in IMG/M
3300013100|Ga0157373_10329085Not Available1088Open in IMG/M
3300013297|Ga0157378_10698758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae1033Open in IMG/M
3300013306|Ga0163162_12289122Not Available621Open in IMG/M
3300014745|Ga0157377_10230117All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300014745|Ga0157377_10836261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium madagascariense682Open in IMG/M
3300015374|Ga0132255_104611343Not Available584Open in IMG/M
3300017966|Ga0187776_10213068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1220Open in IMG/M
3300017966|Ga0187776_10454698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium867Open in IMG/M
3300021361|Ga0213872_10265404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia720Open in IMG/M
3300021439|Ga0213879_10064171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia990Open in IMG/M
3300025711|Ga0207696_1131967Not Available671Open in IMG/M
3300025898|Ga0207692_10573362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae723Open in IMG/M
3300025899|Ga0207642_10606973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae682Open in IMG/M
3300025903|Ga0207680_10365210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae1016Open in IMG/M
3300025923|Ga0207681_10535139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia963Open in IMG/M
3300025926|Ga0207659_11856611Not Available511Open in IMG/M
3300025927|Ga0207687_10196893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1572Open in IMG/M
3300025934|Ga0207686_10308751Not Available1177Open in IMG/M
3300025938|Ga0207704_10493781All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300025939|Ga0207665_10195170All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300025986|Ga0207658_10197319All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300026067|Ga0207678_10248313All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1524Open in IMG/M
3300026089|Ga0207648_10127474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae2239Open in IMG/M
3300026089|Ga0207648_10366294All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1301Open in IMG/M
3300026089|Ga0207648_10489410All Organisms → cellular organisms → Bacteria → Terrabacteria group1124Open in IMG/M
3300026089|Ga0207648_10579798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1032Open in IMG/M
3300026118|Ga0207675_100683107Not Available1034Open in IMG/M
3300026118|Ga0207675_100761714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium kubicae980Open in IMG/M
3300026142|Ga0207698_12643788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae511Open in IMG/M
3300027603|Ga0209331_1008869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2653Open in IMG/M
3300027824|Ga0209040_10175939All Organisms → cellular organisms → Bacteria → Terrabacteria group1132Open in IMG/M
3300028380|Ga0268265_10198006All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300028380|Ga0268265_12449756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales528Open in IMG/M
3300028381|Ga0268264_12531670All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300028381|Ga0268264_12701783Not Available500Open in IMG/M
3300031962|Ga0307479_10469288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1242Open in IMG/M
3300032174|Ga0307470_11180446Not Available620Open in IMG/M
3300032205|Ga0307472_101890776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae595Open in IMG/M
3300032782|Ga0335082_10615276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae948Open in IMG/M
3300032892|Ga0335081_10497694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1534Open in IMG/M
3300032892|Ga0335081_10862073All Organisms → cellular organisms → Bacteria → Terrabacteria group1073Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere9.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere8.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil7.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.00%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0943.000059402166559005SimulatedMWVPRSATADWPADDRIGISVLDCLHCDGTGTVCLDPGRGNRPTRSGR
JGI24750J21931_103531713300002070Corn, Switchgrass And Miscanthus RhizosphereADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0062590_10016685313300004157SoilPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0063356_10016256853300004463Arabidopsis Thaliana RhizosphereTADWPADDRIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR*
Ga0070676_1089851423300005328Miscanthus RhizosphereMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRPGVP*
Ga0068869_10008672113300005334Miscanthus RhizosphereEASMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG*
Ga0070666_1019670533300005335Switchgrass RhizosphereWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0070689_10029182023300005340Switchgrass RhizosphereAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0070668_10068426033300005347Switchgrass RhizosphereMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRG
Ga0070674_10008135633300005356Miscanthus RhizosphereQLAYDLEATMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPARGNRPTRSGR*
Ga0070688_10054172533300005365Switchgrass RhizosphereMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR*
Ga0070688_10118752513300005365Switchgrass RhizosphereMWVPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGPGNRPTRSGR*
Ga0070667_10009336353300005367Switchgrass RhizosphereGDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR
Ga0070667_10079942333300005367Switchgrass RhizosphereLAYDLEATMWVPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0070710_1019077813300005437Corn, Switchgrass And Miscanthus RhizosphereMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0070710_1034157723300005437Corn, Switchgrass And Miscanthus RhizosphereMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0070711_10019545913300005439Corn, Switchgrass And Miscanthus RhizosphereECAGDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0070700_10009420433300005441Corn, Switchgrass And Miscanthus RhizosphereCAGDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0070700_10065518713300005441Corn, Switchgrass And Miscanthus RhizosphereAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR*
Ga0070663_10079566823300005455Corn RhizosphereADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0070662_10022598723300005457Corn RhizosphereMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0070707_10138958513300005468Corn, Switchgrass And Miscanthus RhizosphereTADWPADDCIGISVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0070672_10046304423300005543Miscanthus RhizosphereTADWPADDRIGISVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0070695_10086397823300005545Corn, Switchgrass And Miscanthus RhizosphereLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0070665_10166007813300005548Switchgrass RhizosphereMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTK
Ga0070704_10151631113300005549Corn, Switchgrass And Miscanthus RhizosphereATADWPADDGIGISVLDCPQCDGTGTVRLDPRRGNRPTRSGR*
Ga0068855_10160461713300005563Corn RhizosphereLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR*
Ga0068854_10013292513300005578Corn RhizosphereATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0068859_10156235413300005617Switchgrass RhizosphereDWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0070716_10010603613300006173Corn, Switchgrass And Miscanthus RhizosphereAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPARGNRPTRSGR*
Ga0070712_10031403923300006175Corn, Switchgrass And Miscanthus RhizosphereDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR*
Ga0068865_10004992613300006881Miscanthus RhizosphereDWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG*
Ga0068865_10036771733300006881Miscanthus RhizosphereADDCIGISVLDCLQCDGTGTVRLDPGRGSRPTRSGR*
Ga0105250_1005524113300009092Switchgrass RhizosphereTADWPADDCIGISELDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0105245_1203283313300009098Miscanthus RhizosphereDDRIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR*
Ga0105247_1107123833300009101Switchgrass RhizosphereRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR*
Ga0105243_1028283413300009148Miscanthus RhizosphereECAGDGQLAYDLEAAMWVPRSATADWAADDCIGISVLDCLQCDGTGTVRLDSGRGDRPTRSGR*
Ga0105243_1210007913300009148Miscanthus RhizosphereTADWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG*
Ga0105241_1021298413300009174Corn RhizosphereECAGDGQLAYDLEASVWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR*
Ga0105242_1238600713300009176Miscanthus RhizosphereMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0105238_1070867923300009551Corn RhizosphereCAGDGQLAYDLEASMWVPRSATADWPAADCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0105249_1010054343300009553Switchgrass RhizosphereWVPRGATADWPADDCIGISVIDCLQCDGTGTVRLDPGHGNRPRRSGQ*
Ga0105249_1191164913300009553Switchgrass RhizosphereCAGDGQLAYDLEAAMWVPRSATADWPADDGIGISVLDCPQCDGTGTVRLDPRRGNRPTRSGR*
Ga0134125_1183180723300010371Terrestrial SoilGDGQLAYDQEASMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG*
Ga0134128_1166253113300010373Terrestrial SoilYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0134126_1144744523300010396Terrestrial SoilGDGQLAYDQEASMWVPRSATADWPADDCIGICVIDCLQCDGTGTVRLDPGHGNRPRRSGQ
Ga0134124_1147462123300010397Terrestrial SoilYDLEAAMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR*
Ga0134122_1152821623300010400Terrestrial SoilMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR*
Ga0134122_1161059613300010400Terrestrial SoilMWVPRSATADWPADDGIGISVLDCPQCDGTGTVRLDPRRGNRPTRSGR*
Ga0134123_1044316113300010403Terrestrial SoilPADDCIGISVLDCLQCDGTGTVRLDPGPGNRPTRSGR*
Ga0164301_1088203213300012960SoilYDLEATMWVPRSATADWPADDRIGASVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0164301_1146471023300012960SoilGQLAYDLEAAMWVPRSATADWAADDCIGISVLDCLQCNGTGTVWLDPGHGSRPTRSGR*
Ga0164309_1189234413300012984SoilMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG*
Ga0164308_1068183633300012985SoilQLAYDLEATMWVPRSATADWPAYDRIGISVLDCLQCDGTGTVRLDPARGNRRTRSGR*
Ga0164308_1197584013300012985SoilDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRFGR*
Ga0164304_1157439813300012986SoilGDGQLAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVQLDPGRGNRPTRSGR
Ga0164306_1035185823300012988SoilAGDGQLAYDLEATMWVPRSATADWPADDCIGISVLDCRQCDGTGTVRLDPGRGNRPTRSGR*
Ga0164305_1172258823300012989SoilGDGQLAYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0157307_113456613300013096SoilECAGDGQLAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGMVRLDPGRGNRPTRSGR*
Ga0157373_1032908533300013100Corn RhizosphereYDLEATMWVPRSAAADWPADDCIGISVLDCLQCDGTGTVRLDSGRGNRPRRSGR*
Ga0157378_1069875813300013297Miscanthus RhizosphereRGLAPDDCIGISVLYCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0163162_1228912223300013306Switchgrass RhizospherePADDGIGISVLDCPQCDGTGTVRLDPRRGNRPTRSGR*
Ga0157377_1023011713300014745Miscanthus RhizosphereADDRIGISVLDCLQCDGTGTVRLDPGRNRPTRSG*
Ga0157377_1083626123300014745Miscanthus RhizosphereGQLAYDLEAAMWVPRSATADWPADDRIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0132255_10461134313300015374Arabidopsis RhizosphereMWVPRSATADWSADDRIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR*
Ga0187776_1021306833300017966Tropical PeatlandVCDECAGDGQLAYDLEATMWVPRSATADWPANDCIGISVLDCLQCDGTGTVRLDP
Ga0187776_1045469813300017966Tropical PeatlandDDCIGISVLDCLQCDGTGTVRCDPGRANRPTRSGR
Ga0213872_1026540423300021361RhizosphereDGQLAYDPEAAMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRANRPTRSGR
Ga0213879_1006417113300021439Bulk SoilYDLEAAMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDAGRANRPTRSGR
Ga0207696_113196723300025711Switchgrass RhizosphereMWVPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGRGNPPTRSGR
Ga0207692_1057336233300025898Corn, Switchgrass And Miscanthus RhizosphereASMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207642_1060697333300025899Miscanthus RhizosphereDGQLAYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207680_1036521013300025903Switchgrass RhizosphereWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207681_1053513933300025923Switchgrass RhizosphereMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207659_1185661123300025926Miscanthus RhizosphereMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207687_1019689333300025927Miscanthus RhizosphereWPADDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207686_1030875113300025934Miscanthus RhizosphereMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR
Ga0207704_1049378113300025938Miscanthus RhizosphereAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR
Ga0207665_1019517013300025939Corn, Switchgrass And Miscanthus RhizosphereGQLAYDLEASVWIPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR
Ga0207658_1019731913300025986Switchgrass RhizosphereDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR
Ga0207678_1024831313300026067Corn RhizosphereTMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR
Ga0207648_1012747443300026089Miscanthus RhizosphereECAGDGQLAYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207648_1036629413300026089Miscanthus RhizosphereECAGDGQLAYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR
Ga0207648_1048941023300026089Miscanthus RhizosphereLEATMWVPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGPGNRPTRSAGNSADLGVP
Ga0207648_1057979813300026089Miscanthus RhizosphereWRSPVIGISVRDYLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207675_10068310723300026118Switchgrass RhizosphereADWPADDCIGISVLDCLQCDGTGTVRLDPGRGDPPTRSGR
Ga0207675_10076171413300026118Switchgrass RhizosphereCAGDGQLAYDLEATMWVPRSATADWPADDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0207698_1264378813300026142Corn RhizosphereAYDLEATMWIPRSATADWPADDRIGISVFDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0209331_100886913300027603Forest SoilGGRPAEDCIGISVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0209040_1017593913300027824Bog Forest SoilWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRANRPTRPGR
Ga0268265_1019800613300028380Switchgrass RhizosphereYDLEATMWVPRSATADWPADDCIGVSVLDCLQCDGTGTVRLDPGRGHRPTKSGR
Ga0268265_1244975613300028380Switchgrass RhizosphereSATADWPADDRIGISVLDCLQCDGTGMVRLDPGRGNRATRSGR
Ga0268264_1253167013300028381Switchgrass RhizosphereDWPVDCIGICVLDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0268264_1270178313300028381Switchgrass RhizosphereGQLAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR
Ga0307479_1046928823300031962Hardwood Forest SoilLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRANRPTRSGR
Ga0307470_1118044613300032174Hardwood Forest SoilPADWPADDCIGISVLDCLQCDGTGTVRLDPGRGNPPTRSGR
Ga0307472_10189077623300032205Hardwood Forest SoilATADWPADDRIGISVFDCLQCDGTGTVRLDPGRGNRPTRSGR
Ga0335082_1061527613300032782SoilMWVPRSATADWPADERIGISVLDCLQCDGTGTVRLDPGRGNRATRSGR
Ga0335081_1049769423300032892SoilAGDGQLAYDLEATMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPGRANRPTRSG
Ga0335081_1086207313300032892SoilDGQLAYDLEAAMWVPRSATADWPADDCIGISVLDCLQCDGTGTVRLDPERANRPTRSGR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.