| Basic Information | |
|---|---|
| Family ID | F105770 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MIDSETVVGTGLRITVAKDELAAKLATVARGVSTRTAVLVLGGIQLR |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.00% β-sheet: 0.00% Coil/Unstructured: 68.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF08299 | Bac_DnaA_C | 88.00 |
| PF11638 | DnaA_N | 4.00 |
| PF00712 | DNA_pol3_beta | 3.00 |
| PF01656 | CbiA | 1.00 |
| PF00468 | Ribosomal_L34 | 1.00 |
| PF02767 | DNA_pol3_beta_2 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 88.00 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 4.00 |
| COG0230 | Ribosomal protein L34 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.00 % |
| Unclassified | root | N/A | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402GCL7H | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300001661|JGI12053J15887_10519886 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300002568|C688J35102_118922772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 613 | Open in IMG/M |
| 3300005336|Ga0070680_101403449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
| 3300005336|Ga0070680_101560729 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005434|Ga0070709_10953201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300005437|Ga0070710_10211104 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300005439|Ga0070711_100698817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 854 | Open in IMG/M |
| 3300005524|Ga0070737_10243612 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005529|Ga0070741_11416530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 577 | Open in IMG/M |
| 3300005547|Ga0070693_101218188 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005555|Ga0066692_10806972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300005556|Ga0066707_10577069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300005557|Ga0066704_10568844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 735 | Open in IMG/M |
| 3300005563|Ga0068855_100028490 | All Organisms → cellular organisms → Bacteria | 6680 | Open in IMG/M |
| 3300005614|Ga0068856_100619960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1103 | Open in IMG/M |
| 3300005834|Ga0068851_10564643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
| 3300006173|Ga0070716_100209427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1302 | Open in IMG/M |
| 3300006237|Ga0097621_100504821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1096 | Open in IMG/M |
| 3300006237|Ga0097621_101052398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 763 | Open in IMG/M |
| 3300006638|Ga0075522_10312756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 759 | Open in IMG/M |
| 3300006794|Ga0066658_10937367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300006804|Ga0079221_11602016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300006871|Ga0075434_102390525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300006904|Ga0075424_101596153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
| 3300006914|Ga0075436_100652013 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300009156|Ga0111538_12904877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300009176|Ga0105242_10622561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1046 | Open in IMG/M |
| 3300009176|Ga0105242_12357117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300009545|Ga0105237_12623571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300009551|Ga0105238_12229806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300009792|Ga0126374_10727837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 749 | Open in IMG/M |
| 3300010089|Ga0127454_1099491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300010359|Ga0126376_10762810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 939 | Open in IMG/M |
| 3300010401|Ga0134121_11535907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300011969|Ga0120166_1021733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300012019|Ga0120139_1158306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 592 | Open in IMG/M |
| 3300012200|Ga0137382_11269443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300012201|Ga0137365_10881992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 653 | Open in IMG/M |
| 3300012210|Ga0137378_11816308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300012211|Ga0137377_11860766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300012354|Ga0137366_11070365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300012355|Ga0137369_10915052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300012362|Ga0137361_11512549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300012363|Ga0137390_10411333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1330 | Open in IMG/M |
| 3300012401|Ga0134055_1004775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300012406|Ga0134053_1147293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1033 | Open in IMG/M |
| 3300012469|Ga0150984_102739248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 928 | Open in IMG/M |
| 3300012469|Ga0150984_103949065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300012517|Ga0157354_1011637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 895 | Open in IMG/M |
| 3300012957|Ga0164303_11247972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300012958|Ga0164299_11281590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300012960|Ga0164301_10884392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
| 3300012960|Ga0164301_11731002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300012971|Ga0126369_12812812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300012971|Ga0126369_13712010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300013297|Ga0157378_12237311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
| 3300015068|Ga0167645_122605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300017937|Ga0187809_10216036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
| 3300020076|Ga0206355_1273627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1453 | Open in IMG/M |
| 3300021560|Ga0126371_13118253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300025482|Ga0208715_1036676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 912 | Open in IMG/M |
| 3300025898|Ga0207692_10940670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300025911|Ga0207654_11371011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300025913|Ga0207695_10124149 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300025921|Ga0207652_10723529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 887 | Open in IMG/M |
| 3300025928|Ga0207700_11869005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300025929|Ga0207664_10623975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 968 | Open in IMG/M |
| 3300025939|Ga0207665_10898585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300025949|Ga0207667_10116063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2759 | Open in IMG/M |
| 3300025949|Ga0207667_10218662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1952 | Open in IMG/M |
| 3300025960|Ga0207651_11991135 | Not Available | 522 | Open in IMG/M |
| 3300025981|Ga0207640_10739908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 847 | Open in IMG/M |
| 3300026067|Ga0207678_10636996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 936 | Open in IMG/M |
| 3300026067|Ga0207678_11478646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300026216|Ga0209903_1034557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
| 3300028536|Ga0137415_10703885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 823 | Open in IMG/M |
| 3300028577|Ga0265318_10297631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300028800|Ga0265338_10372370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1023 | Open in IMG/M |
| 3300031239|Ga0265328_10269319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
| 3300031251|Ga0265327_10381225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300031549|Ga0318571_10163530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 776 | Open in IMG/M |
| 3300031561|Ga0318528_10251683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 948 | Open in IMG/M |
| 3300031720|Ga0307469_12414891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300031736|Ga0318501_10278133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 890 | Open in IMG/M |
| 3300031768|Ga0318509_10545869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300031805|Ga0318497_10362747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 809 | Open in IMG/M |
| 3300031819|Ga0318568_10066036 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 3300031938|Ga0308175_100516797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1272 | Open in IMG/M |
| 3300031938|Ga0308175_102385412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300031954|Ga0306926_12076094 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 637 | Open in IMG/M |
| 3300031996|Ga0308176_11431799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 735 | Open in IMG/M |
| 3300032055|Ga0318575_10169405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1091 | Open in IMG/M |
| 3300032065|Ga0318513_10215431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 927 | Open in IMG/M |
| 3300032089|Ga0318525_10022077 | All Organisms → cellular organisms → Bacteria | 3031 | Open in IMG/M |
| 3300032829|Ga0335070_11611060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300032954|Ga0335083_10394584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1185 | Open in IMG/M |
| 3300032955|Ga0335076_10806390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 821 | Open in IMG/M |
| 3300032955|Ga0335076_11599591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300034268|Ga0372943_0870055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.00% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.00% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010089 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011969 | Permafrost microbial communities from Nunavut, Canada - A23_80cm_12M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015068 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08190050 | 2189573004 | Grass Soil | MVETALKLTVSRDVLAEHLAVVARAVSARTTVLVL |
| JGI12053J15887_105198862 | 3300001661 | Forest Soil | MIDSETLVGTGLRITVSKDELAAKLAVVARGVSTRTTVLVLGGI |
| C688J35102_1189227721 | 3300002568 | Soil | MIDSDIVVGTGLRITVSRDEFAQKLAVVSRGVSTRTAVLVLGGIRLHAEGGRL |
| Ga0070680_1014034491 | 3300005336 | Corn Rhizosphere | MIDSEIMVGTGLRIIVSKDELAAKLATVARGVSTRTAVLV |
| Ga0070680_1015607291 | 3300005336 | Corn Rhizosphere | MIDSETVVGTGLRITVSKDELASKLAVVARGVSTRTTVLVLGGIQLRAEA |
| Ga0070709_109532011 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSEMMVGTGLRITVAKDELASKLATVARGVSTRTAVLV |
| Ga0070710_102111042 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSELMVGAGLRITVSKDELAAKLAVVARGVSTRTAVLVLGGIQLRAEAGR |
| Ga0070711_1006988171 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSETVVGTGLRITVSKDDLAAKLAIVARGVSTRTAVLVLGGIQLRAEAGRLH |
| Ga0070737_102436121 | 3300005524 | Surface Soil | MIDSDIVVGTGLRITVSKDELAGRLAIVARGVSTRTAVLVLGGIQLRAEGTRLHL |
| Ga0070741_114165301 | 3300005529 | Surface Soil | MIDSEIMVGTGLRITVSKEELAGKLAVVARGVSTRTAVLVLGGIQLRA |
| Ga0070693_1012181881 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSETIVGTGLRITVAKDELAAKLTTVARGVSTRTAVLVLGGIQLRAE |
| Ga0066692_108069721 | 3300005555 | Soil | MIDSETVVGTGLRITVAKDELAAKLAIVARGVSTRTTVL |
| Ga0066707_105770691 | 3300005556 | Soil | MIDSEIVVGTGLRITLSRDELASRLAVVARGVSTRTAVL |
| Ga0066704_105688442 | 3300005557 | Soil | MIDSEIVVGTGLRITLSRDELASRLAVVARGVSTRTAVLVLGGI |
| Ga0068855_1000284901 | 3300005563 | Corn Rhizosphere | MIDSETVLNTGVLKISASRDVLAERLALVARGVSTRTAVLVLGGIQLRA |
| Ga0068856_1006199602 | 3300005614 | Corn Rhizosphere | MIDSETVVGSGLRITVEKDELATKLGIVARGVSSRTAVL |
| Ga0068851_105646431 | 3300005834 | Corn Rhizosphere | MIDSEIVMGTGLRITVAKDELAAKLALVARGVSTRTAVLVLGG |
| Ga0070716_1002094271 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSELMVGAGLRITVSKDELAAKLAVVARGVSTRTAVLVLGGIQLRAEAGRLN |
| Ga0097621_1005048212 | 3300006237 | Miscanthus Rhizosphere | MIDSELMVGAGLRITVSKDELAAKLAVVARGVSTRTAVLVLGGIQLRA |
| Ga0097621_1010523981 | 3300006237 | Miscanthus Rhizosphere | MIDSEIVMGTGLRITVAKDELAAKLALVARGVSTRTAVLVLGGIQL |
| Ga0075522_103127562 | 3300006638 | Arctic Peat Soil | MIDSETVVGSGLRITAEKDELAAKLGIVARGVSSRTAVLVLGGI |
| Ga0066658_109373672 | 3300006794 | Soil | MIDSEIVVGTGLRISLSRDELASRLAIVARGVSTRTAVLVLGGI |
| Ga0079221_116020161 | 3300006804 | Agricultural Soil | MIDSETVVGTGLRITASRDELAARLGVVARGVSTRTTVLVLGGIQLQAADGRL |
| Ga0075434_1023905251 | 3300006871 | Populus Rhizosphere | MIDSEIVVGTGLRITVSRDELASRLAVVARGVSTRTTVLVL |
| Ga0075424_1015961531 | 3300006904 | Populus Rhizosphere | MIDSEIVVGTGLRITVSRDELASRLAVVARGVSTR |
| Ga0075436_1006520132 | 3300006914 | Populus Rhizosphere | MIDSEIMVGTGLRITVAKDELASKLATIARGVSSRTAVLVLGGIQLRAEAGRLHLAA |
| Ga0111538_129048771 | 3300009156 | Populus Rhizosphere | MIDSDIVVGTGLRITVSRDELAQKLGVVSRGVSTRTAVLVLGGIQLHAEG |
| Ga0105242_106225612 | 3300009176 | Miscanthus Rhizosphere | MIDSEIVVGTGLRITVSRDELASRLAVVARGVSTRTTVLVLGGIQ |
| Ga0105242_123571172 | 3300009176 | Miscanthus Rhizosphere | MIDSEIVVGTGLRMTVSRDELASRLAIVARGVSTRTTVLVLGG |
| Ga0105237_126235711 | 3300009545 | Corn Rhizosphere | MIDSEIMVGTGLRITVAKDELASKLATVARGVSTRTAVLV |
| Ga0105238_122298062 | 3300009551 | Corn Rhizosphere | MIDSEIVMGTGLRITVAKDELAAKLAIVARGVSTRTAVLVLGGIQLRAEEGSL |
| Ga0126374_107278372 | 3300009792 | Tropical Forest Soil | MIDSELMVGAGLRITVPKDELASKLSVVARGVSTRTAVLVL |
| Ga0127454_10994911 | 3300010089 | Grasslands Soil | MIDSEIVVGTGLRITLSRDELASRLAVVARGVSTR |
| Ga0126376_107628102 | 3300010359 | Tropical Forest Soil | MIDSEMMVGTGLRITVAKDELASKLATVARGVSTRTAVLVLGGIQL |
| Ga0134121_115359073 | 3300010401 | Terrestrial Soil | MIDSEIVVGTGLRMTVSRDELASRLAIVARGVSTRTTVLVLGGI |
| Ga0120166_10217331 | 3300011969 | Permafrost | MIDSETVVGTGLRITASKNDLASRLSIVARGVSTRTAVLVLGGIQLRAEA |
| Ga0120139_11583061 | 3300012019 | Permafrost | MIDSETLVGAGLRITVAKDELSSKLAIVARGVSARTAVLVLGGIQLR |
| Ga0137382_112694432 | 3300012200 | Vadose Zone Soil | MIDSDIVVGTGLRITVAKDELAAKLAAVARGVSARATVLVLGGIQLRSEGGQLHLAA |
| Ga0137365_108819922 | 3300012201 | Vadose Zone Soil | MIDSETVVGTGLRITVAKDELAAKLGVVARGVSTRTTL |
| Ga0137378_118163082 | 3300012210 | Vadose Zone Soil | MIDSETVVGTGLRITVAKDELAAKLATVARGVSTRTAVLVLGGIQLR |
| Ga0137377_118607661 | 3300012211 | Vadose Zone Soil | MIDSEIVVGTGLRITLSRDELASRLAVVARGVSTRTAVLVLGGIQLR |
| Ga0137366_110703651 | 3300012354 | Vadose Zone Soil | MIDSELVVGAELRITVSRDELAQKLSVVARGVSTRTSVLVLGGIQLRAEAGKLH |
| Ga0137369_109150521 | 3300012355 | Vadose Zone Soil | MIDSETVLNTGVLKISVSRDVLAERLSLVARGVSARTAVLVLGGIQLRAAGGQLHL |
| Ga0137361_115125491 | 3300012362 | Vadose Zone Soil | MIDSELMVGTGLRIIVPKDELAARLAVVARGVSTRTAVLVLGGIQLRAEAGR |
| Ga0137390_104113332 | 3300012363 | Vadose Zone Soil | MIDSETVVGTGLRITVSKDELAARLAIVARGISTRTAVLVLGGIK |
| Ga0134055_10047751 | 3300012401 | Grasslands Soil | MIDSEIVVGTGLRITLSRDELASRLAVVARGVSTRTAVLVLGGIQLRAEAGRLNLAA |
| Ga0134053_11472932 | 3300012406 | Grasslands Soil | MIDSELMVGTGLRITVPKDELAARLAVVARGVSTRTAVLVLGGIQLRAEAGRLH |
| Ga0150984_1027392482 | 3300012469 | Avena Fatua Rhizosphere | VGTGLRITVPKDELSSKLAIVARGVSTRTAVLVLGGI* |
| Ga0150984_1039490651 | 3300012469 | Avena Fatua Rhizosphere | MIDSEIVVGTGLRITVSRDELASKLAIVSRGVSTRTTVL |
| Ga0157354_10116371 | 3300012517 | Unplanted Soil | MIDSDIVVGTGLRITVPKDELASKLGLVSRGVSTRTAVL |
| Ga0164303_112479722 | 3300012957 | Soil | MIDSEIVVGTGLRMTVSRDELAGRLATVARGVSTRTTVLVLGGIQLR |
| Ga0164299_112815901 | 3300012958 | Soil | MIDSETVVGTGLRITVSKDELAAKLGVVARGVSTRTTVLVLGGIQLRAEAGQ |
| Ga0164301_108843921 | 3300012960 | Soil | MIDSETVVGTGLRITVAKDELAAKLAIVARGVSTRTA |
| Ga0164301_117310021 | 3300012960 | Soil | MVGTGLRITVAKDELASKLATVARGVSTRTAVLVLGGIQLRAEAGRL |
| Ga0126369_128128122 | 3300012971 | Tropical Forest Soil | MIDSETVVGTGLRITVPRDELAAKLGVVARGVSSRATVLVLGGIQ |
| Ga0126369_137120102 | 3300012971 | Tropical Forest Soil | MIDSDIVVGTGLRITVAKDELAAKLATVARGVSTRATVLVLGGIQLRAEAGQLHL |
| Ga0157378_122373112 | 3300013297 | Miscanthus Rhizosphere | MIDSEIVVGTGLRITVSRDELASRLAVVARGVSTRTTVLVLGGIQLRAE |
| Ga0167645_1226052 | 3300015068 | Glacier Forefield Soil | MIDSETIVGTGLRITVSKDELAARLAIVARGVSTRTAVLVLGGIQLRAEA |
| Ga0187809_102160362 | 3300017937 | Freshwater Sediment | MIDSEIVVGTGFRIVVSKDDLAGRLAIVARGVSTR |
| Ga0206355_12736271 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSELMVGTGLRITVAKDELAAKLATVARGVSTRTAVLVLGGIQLRA |
| Ga0126371_131182531 | 3300021560 | Tropical Forest Soil | MIDSEIVVGTGFRIVVAKDDLAARLAIVARGVSTRTAVLVLGGIQLR |
| Ga0208715_10366761 | 3300025482 | Arctic Peat Soil | MIDSETVVGTGLRITVSKDELAAKLGIVARGVSTRT |
| Ga0207692_109406702 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSETVVGTGLRITVPKDDLAAKLAIVARGVSTRTTVLV |
| Ga0207654_113710111 | 3300025911 | Corn Rhizosphere | MIDSEIMVGAGLRITVAKDELASKLTTVARGVSTRT |
| Ga0207695_101241491 | 3300025913 | Corn Rhizosphere | MIDSETVVGSGLRITVEKDELATKLGIVARGVSSRTAVLVLGGIQLRAEGGRLHL |
| Ga0207652_107235292 | 3300025921 | Corn Rhizosphere | MIDSEIMVGTGLRITVAKDELASKLATVARGVSTRTAVLVLGGIQ |
| Ga0207700_118690052 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSEVVVGTGLRISIPKDELSSKLAIVARGVSTRTAVLVLGGIQLRAEGGQLHLAA |
| Ga0207664_106239751 | 3300025929 | Agricultural Soil | MIDSELMVGTGLRITVAKDELAAKLATVARGVSTRTAVLVL |
| Ga0207665_108985851 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSETVVGTGLRITVTKDELAAKLAIVARGVSTRTTVLVLGGIQLRAEAGHLHLAGQIALEGN |
| Ga0207667_101160635 | 3300025949 | Corn Rhizosphere | MIDSETIVGTGLRITVAKDELAAKLTTVARGVSTRTAVL |
| Ga0207667_102186621 | 3300025949 | Corn Rhizosphere | MIDSETVVGTGLRITVAKDELAAKLGVVARGVSARTTVLVL |
| Ga0207651_119911351 | 3300025960 | Switchgrass Rhizosphere | MIDSELMLGAGLRITVSKDELAAKLAVVARGVSTRTAVLVLGGIQLRAEAGR |
| Ga0207640_107399082 | 3300025981 | Corn Rhizosphere | MIDSEIMVGTGLRITVAKDELAAKLATVARGVSTRTA |
| Ga0207678_106369961 | 3300026067 | Corn Rhizosphere | MIDSEIMVGTGLRITVAKEELASKLATVARGVSTRTA |
| Ga0207678_114786462 | 3300026067 | Corn Rhizosphere | MIDSEIVVGTGLRITVPKDELASQLAIVARGVSTRTAVLVL |
| Ga0209903_10345571 | 3300026216 | Soil | MIDSETVVGTGLRITVPKDELAARLATVARGVSTRTAVLVLA |
| Ga0137415_107038852 | 3300028536 | Vadose Zone Soil | MIDSETLVGAGLRITVAKDELSSKLATVARGVSTRTAVLVLGGIHMS |
| Ga0265318_102976311 | 3300028577 | Rhizosphere | MIDSEIVMGTGLRITVSRDDLAARLALVARGVSTRT |
| Ga0265338_103723701 | 3300028800 | Rhizosphere | MIDSEIVMGTGLRITVSRDDLAAKLALVARGVSTRTTVLVLGGIQLRAEGG |
| Ga0265328_102693192 | 3300031239 | Rhizosphere | MIDSETVVGTGLRITVAKDELAAKLAVVARGVSTRTTVLVLGGIQL |
| Ga0265327_103812251 | 3300031251 | Rhizosphere | MIDSETVVGAGLRITVAKDELASTLAVVARGVSSRTAVLV |
| Ga0318571_101635302 | 3300031549 | Soil | MIDSELVVGTGLRMTVSRDELAAKLAIVSRGVSTRTAVLVLGGIQL |
| Ga0318528_102516831 | 3300031561 | Soil | MIDSETVVGTGLQITLSRDELAAKLGVVSRAVSARTT |
| Ga0307469_124148911 | 3300031720 | Hardwood Forest Soil | MIDSEMMVGTGLRITVAKDELASKLTTVARGVSTRTAVLVLGGIQLRAEA |
| Ga0318501_102781331 | 3300031736 | Soil | MIDSELVVGTGLRMTVSRDELAAKLAIVSRGVSTRTA |
| Ga0318509_105458691 | 3300031768 | Soil | MIDSETVVGTGLQITLSRDELAAKLGVVSRAVSARTTVLVLG |
| Ga0318497_103627472 | 3300031805 | Soil | MIDSELVVGTGLRMTVSRDELAAKLAIVSRGVSTRTAVLVE |
| Ga0318568_100660361 | 3300031819 | Soil | MIDSELVVGTGLRMTVSRDELAAKLAIVSRGVSTRTAVLVLGGIQLRAEAGRLHL |
| Ga0308175_1005167971 | 3300031938 | Soil | MIDSEIMVGTGLRITVSKDELASRLATVARGVSTRTAVLVLGGIQLRAEE |
| Ga0308175_1023854122 | 3300031938 | Soil | MIDSDIVVGTGLRITASRDELAQKLGVVSRGVSTRTAVLVLGGIQL |
| Ga0306926_120760941 | 3300031954 | Soil | MIDSELVVGAGLRITASRDELTSKLAVVARGVSTRTAVLVLGGIQLHAEAG |
| Ga0308176_114317991 | 3300031996 | Soil | MIDSDIVVGTGLRITVSKDDLAGRLAIVARGVSTRTAVLVLGGIQL |
| Ga0318575_101694051 | 3300032055 | Soil | MIDSELVVGAGLRITASRDELTSKLAVVARGVSTRTAVLVLGGIQLHAEAGKLHLAA |
| Ga0318513_102154311 | 3300032065 | Soil | MIDSETVVGTGLQITLSRDELAAKLGVVSRAVSAR |
| Ga0318525_100220776 | 3300032089 | Soil | VIDSELVVGTGLRMTVSRDELAAKLAIVSRGVSTRTAVLVLG |
| Ga0335070_116110601 | 3300032829 | Soil | MVGTGLRITVSKDELAGKLATVARGVSTRTTVLVLGGIQLRVEG |
| Ga0335083_103945842 | 3300032954 | Soil | MIDSETVVGTGLRITVAKDELAAKLATVARGVSTRTTVLVLGGIQLR |
| Ga0335076_108063902 | 3300032955 | Soil | MIDSEIVVGTGFRIVVAKDDLAGRLAIVARGVSTRT |
| Ga0335076_115995911 | 3300032955 | Soil | MIDSETVVGTGLQIGVSRDELAAKLTIVSRAVSTRTTVL |
| Ga0372943_0870055_2_121 | 3300034268 | Soil | MIDSETVVGTGLRITVAKDELSAKLAIVARGVSTRTTVLV |
| ⦗Top⦘ |